. A nonapeptide was treated with 6N HCl at 110 oC for 24 hours and was determined to have the following amino acid composition: (Lys)2, (Gly)2, Met, Leu, (Phe)2, His. The native peptide was incubated with 1-fluoro-2,4-dinitrobenzene (FDNB) and then, hydrolyzed by a strong acid. 2,4-Dinitrophenylhistidine derivative was identified by the HPLC. When the native peptide was exposed to cyanogen bromide (CNBr), an octapeptide and a free glycine were recovered. Incubation of the native peptide with trypsin gave a pentapeptide, a tripeptide, and a free Lys. 2,4-Dinitrophenylhistidine was recovered from the pentapeptide, and 2,4-dinitrophenyl-phenylalanine was recovered from the tripeptide. What is the native sequence of this nonapeptide? Explain
. A nonapeptide was treated with 6N HCl at 110 oC for 24 hours and was...
I need someone to help explain this to me please in great detail! Explain it to me very simply. thank you! 31) A nonapeptide was determined to have the following amino acid composition: (Lys)2, (Gly)2, (Phe) 2, His, Leu, Met. The following are possible sequences for the peptide. A) G-F-K-K-G-L-M -F-H B) H-L-G-K-K-F-F-G-M C) H-L-F-G-K-K-F-M -G D) H-F-L-G-K-K-F-M-G E) M-L-F-K-F-G-G-K-H The following observations were made during sequence determination. (Hint: FDNB reacts with N-terminal amino groups and specificities of proteases listed...
Styles A decapeptide has the following amina acid composition: Arg. Asp, Gly, Leu, Lys, Met, Phe, Ser. Trp, and Val Reacting the native peptide with FDNB and then hydrolyzing released 2.4- dinitrophenylvaline. Brief incubation of the native peptide with carboxypeptidase yielded free Leu. Incubation with cyanogen bromide yielded two fragments: a tetrapeptide with composition Met, Phe, Ser, and Val, and a hexapeptide. The hexapeptide yielded 2.4- dinitrophenylglycine. Proteolytic cleavage by trypsin of the native peptide gave free Leu, a tripeptide,...
1. Partial hydrolysis of lysozyme yielded an octapeptide that was later identified as the N-terminal segment of the protein. From the following information, determine the sequence of this octapeptide. a. The following amino acids were identified after complete hydrolysis of the octapeptide: Arginine (Arg) Glycine (Gly) Phenylalanine (Phe) Cysteine (Cys) Leucine (Leu) Valine (Val) Glutamic Acid (Glu) Lysine (Lys) b. Treatment of the octapeptide with dinitroflurobenzene (Sanger reagent) followed by complete hydrolysis gave lysine (Lys) labeled with two dinitrophenyl (DNP) groups. c. Treatment of the octapeptide with trypsin gave lysine...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...