. A nonapeptide was treated with 6N HCl at 110 oC for 24 hours and was...
. A nonapeptide was treated with 6N HCl at 110 oC for 24 hours and was determined to have the following amino acid composition: (Lys)2, (Gly)2, Met, Leu, (Phe)2, His. The native peptide was incubated with 1-fluoro-2,4-dinitrobenzene (FDNB) and then, hydrolyzed by a strong acid. 2,4-Dinitrophenylhistidine derivative was identified by the HPLC. When the native peptide was exposed to cyanogen bromide (CNBr), an octapeptide and a free glycine were recovered. Incubation of the native peptide with trypsin gave a pentapeptide, a tripeptide, and a free Lys. 2,4-Dinitrophenylhistidine was recovered from the pentapeptide, and 2,4-dinitrophenyl-phenylalanine was recovered from the tripeptide. What is the native sequence of this nonapeptide? Explain
Homework Answers
Add Answer to:
. A nonapeptide was treated with 6N HCl at 110 oC for 24 hours
and was...
I need someone to help explain this to me please in great detail! Explain it to...
I need someone to help explain this to me please in great
detail! Explain it to me very simply. thank you!
31) A nonapeptide was determined to have the following amino acid composition: (Lys)2, (Gly)2, (Phe) 2, His, Leu, Met. The following are possible sequences for the peptide. A) G-F-K-K-G-L-M -F-H B) H-L-G-K-K-F-F-G-M C) H-L-F-G-K-K-F-M -G D) H-F-L-G-K-K-F-M-G E) M-L-F-K-F-G-G-K-H The following observations were made during sequence determination. (Hint: FDNB reacts with N-terminal amino groups and specificities of proteases listed...
Styles A decapeptide has the following amina acid composition: Arg. Asp, Gly, Leu, Lys, Met, Phe,...
Styles A decapeptide has the following amina acid composition: Arg. Asp, Gly, Leu, Lys, Met, Phe, Ser. Trp, and Val Reacting the native peptide with FDNB and then hydrolyzing released 2.4- dinitrophenylvaline. Brief incubation of the native peptide with carboxypeptidase yielded free Leu. Incubation with cyanogen bromide yielded two fragments: a tetrapeptide with composition Met, Phe, Ser, and Val, and a hexapeptide. The hexapeptide yielded 2.4- dinitrophenylglycine. Proteolytic cleavage by trypsin of the native peptide gave free Leu, a tripeptide,...
1. Partial hydrolysis of lysozyme yielded an octapeptide that was later identified as the N-terminal segment of...
1. Partial hydrolysis of lysozyme yielded an octapeptide that was later identified as the N-terminal segment of the protein. From the following information, determine the sequence of this octapeptide. a. The following amino acids were identified after complete hydrolysis of the octapeptide: Arginine (Arg) Glycine (Gly) Phenylalanine (Phe) Cysteine (Cys) Leucine (Leu) Valine (Val) Glutamic Acid (Glu) Lysine (Lys) b. Treatment of the octapeptide with dinitroflurobenzene (Sanger reagent) followed by complete hydrolysis gave lysine (Lys) labeled with two dinitrophenyl (DNP) groups. c. Treatment of the octapeptide with trypsin gave lysine...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
I need someone to help explain this to me please in great
detail! Explain it to me very simply. thank you!
31) A nonapeptide was determined to have the following amino acid composition: (Lys)2, (Gly)2, (Phe) 2, His, Leu, Met. The following are possible sequences for the peptide. A) G-F-K-K-G-L-M -F-H B) H-L-G-K-K-F-F-G-M C) H-L-F-G-K-K-F-M -G D) H-F-L-G-K-K-F-M-G E) M-L-F-K-F-G-G-K-H The following observations were made during sequence determination. (Hint: FDNB reacts with N-terminal amino groups and specificities of proteases listed...
Styles A decapeptide has the following amina acid composition: Arg. Asp, Gly, Leu, Lys, Met, Phe, Ser. Trp, and Val Reacting the native peptide with FDNB and then hydrolyzing released 2.4- dinitrophenylvaline. Brief incubation of the native peptide with carboxypeptidase yielded free Leu. Incubation with cyanogen bromide yielded two fragments: a tetrapeptide with composition Met, Phe, Ser, and Val, and a hexapeptide. The hexapeptide yielded 2.4- dinitrophenylglycine. Proteolytic cleavage by trypsin of the native peptide gave free Leu, a tripeptide,...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
Most questions answered within 3 hours.
-
Work of 1950 J is done by stirring a perfectly insulated beaker
containing 75 g of...
asked 26 minutes ago -
The neighborhood kids set up an outdoor lemonade stand in
Maryland in June. They find that...
asked 28 minutes ago -
9. A company has a beginning inventory of 4,000 units. The
company estimates it will sell...
asked 41 minutes ago -
A patient goes to the doctor's office with symptoms of a urinary
tract infection and provides...
asked 43 minutes ago -
When responding to the essay questions, be sure to cite any
material you obtained from a...
asked 43 minutes ago -
The energy of an electron in a 2.25-eV-deep potential well is
1.50 eV.At what distance into...
asked 45 minutes ago -
Q1:Which three evolutionary innovations are present in land
plants (but not all land plants) that allowed...
asked 48 minutes ago -
Lymphosarcoma is
extremely rare. Risk factors for the disease are largely unknown.
What kind of study...
asked 50 minutes ago -
The solubility of benzoic acid in water is:
0.29g/100mL at 20°C
6.8g/100mL at 100°C
a) What...
asked 52 minutes ago -
Which food law was passed in 1996 and changed how pesticide
residues on food were regulated...
asked 1 hour ago -
companies either hire outside programmers to
write_____ software or use their own internal developers.
asked 1 hour ago -
A magnetic dipole m(t) = m_0*cos(ωt) can be
described as current density j(r,t) = −cm(t) ×...
asked 1 hour ago