We need at least 10 more requests to produce the answer.
0 / 10 have requested this problem solution
The more requests, the faster the answer.
22. Selenocysteine, shown below, is an amino acid found in certain specialized proteins. How many grams...
1. Methionine, CH3SCH CH CH(NH2)CO2H, is an amino acid found in proteins. The Lewis structure of this compound is shown below. What is the hybridization type of each carbon, oxygen, the nitrogen, and the sulfur? H-C-S-C-C-C-C
se 3. If you found that you need 0.2943 mols of copper, how many grams of copper do you need the molar mass of copper from above!) Note that the three conversions you just did above can be strung together as shown below: 8 AgNO, → mols AgNO, → mols Cu — g Cu Imol AgNO, 1 mol Cu 63.55 g Cu 100.0 g AgNO3 169 89. ANO, 2 mol AgNO, Imol Cu
(1 pt) 4. How many stereoisomers does the amino acid isoleucine (shown below) have: Draw (R,R) isoleucine (3 pts) HUN OH
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
Question 22 (2.5 points) How many grams of glucose (C6H1206) are in 3.55 moles of glucose? A) 180. g B) 639 g C) 103 g D) 426 g E) 50.7 g А с ОЕ B D Question 23 (2.5 points) How many grams of MgO are produced when 40.0 grams of O2 react completely with Mg in the following reaction? 2Mg (s) + O2(g) → 2MgO(s) A) 30.4 g B) 50.4 g C) 60.8 g D) 101 g E) 201...
DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2 Gene 1 Gene 3 DNA strand3 TRANSLATION Protein Trp Gly Model 2 ACTIVITY and QUESTIONS 1. Based on the information you can gather from model 1 complete the following sentences: a. The nucleotide Adenine (A) always pairs with the nucleotide b. The nucleotide Guanine (G) always pairs with the...
Just answer and work for questions D and E
please.
The answer for c is 27.3 grams
c) A certain dermatological facial cream (16.0 f. oz, density , 0.960 g/mL) contains 6.00-% HC,H503 by mass. How many grams of HCH,o, are contained in the facial cream? grams of HC,H,O, d) Construct a heat curve diagram for salicylic acid on the graph below. Include labels (and units) for the x-axis, y-axis, melting point, boiling point, ΔΗ,us, and AH,op. Heat Curve Diagram...
Question 2 Salicylic acid, HC,H,0, is a chemical compound used in many facial cleansing products. Figure 2. Structure of Salicylic Acid a) Identify the ionizable hydrogen (HA or Hg) with the correct pk НА lonizable Hydrogen pK, 2.97 HA 13.7 :91 3 19- 10 b) The solubility of salicylic acid in water is 0.210-96 HC,HsOs by mass. What is the pH of an aqueous solution of salicylic acid at saturation? (Assume the density of the solution is 1.00 g/mL). 2-U...
26. 26. In a certain paper chromatography experiment, the Re values of components X, Y, and Z are 0.25, 0.50, and 0.75. If the spot of component Z traveled 72 mm, the solvent front would have traveled A. 18 mm B. 24 mm C. 54 mm D. 96 mm E. 216 mm 27. In the experiment described in question 26, the spot of X would have traveled A. 18 mm B. 24 mm C. 54 mm D. 96 mm E....
____ 1. The diagram below represents serine, a polar, uncharged
amino acid. Which functional group gives serine its
distinct property?
a. H3
b. CH2OH
c. –H
d. COO–
____ 2. The monomers shown below are monomers for which of the
following natural polymers?
a. polysaccharides
b. plastics
c. DNA
d. proteins
____ 3. Which of the following processes illustrates the production
of a protein?
a. specific code for amino acids --> amino acid chain -->
gene --> DNA --> specific...