Show how amino acid residues in polypeptide chain can form ester, imino and thioester crosslinks in proteins.
The amino acid tyrosine residue (Tyr) can form ester crosslinks in proteins.
The amino acid residue histidine (His) can form imine crosslinks in proteins.
The amino acid residue cysteine (Cys) can form thioester crosslinks in proteins.
Show how amino acid residues in polypeptide chain can form ester, imino and thioester crosslinks in...
How many different mRNA sequences can code for a polypeptide chain with the amino acid sequence Met - Leu - Arg? Be sure to include a stop codon. Explain your answer! 5′ ...GGAGCUCGUUGUAUU... 3′ Is this sequence RNA or DNA? How can you tell? Which amino acids are encoded, if the reading frame is as shown, starting from the correct end? What would be the effect on the amino acid sequence if the sequence were changed to 5′ GGAGACUCGUUGUAUU 3′?...
B. Explain how two amino acid residues can form a peptide bond I was able to get A) in this but I don't seem to understand this completely.
please help with these 5
questions
Consider a polypeptide consisting of 19 amino acid residues. Its structure is shown below. Lys-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-Tyr . Draw the fragments that would result if the peptide was treated with trypsin. (No partial credit) . Draw the fragments that would result if the peptide was treated with chymotropsin. (No partial credit) MATCH a term from the list below to each definition. Place the letter of the term in the blank to the left of the definition...
The pK of the side chain of amino acid X in a polypeptide is normally in the range of 9-10 and carries a positive charge when protonated. Suppose you have a soluble globular protein and you find there is an X that has a pK of 6.5. What is the most likely reason for such a large drop in pK? Circle the correct answer. a) X is on the surface of the protein where it ion pairs with the carboxylate...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
Proteins are polymers of amino acids that can exist in ordered structures stabilized by a variety of molecular interactions. However, when certain conditions are changed, the compact structure of a polypeptide chain may collapse into a random coil. This structural change may be regarded as a phase transition occurring at a characteristic transition temperature, the melting temperature, Tm, which increases with the strength and number of intermolecular interactions in the chain. A thermodynamic treatment allows predictions to be made of...
(a) Draw three different amino acid residues connected by two peptide bonds. (b) label each residue (3-letter code is OK). (c) Note bonds that do not rotate with a star (d) Note bonds that do rotate with a semi-circle arrow, including those found in each side chain (e) Of the residues in your drawing, which one contributes most to the entropy of the polypeptide (assume an unfolded state)?
Which of the following amino acids can form crosslinks in proteins or cyclize peptides? C S T M
4. Shown below is a segment from a polypeptide chain. Which amino acid in this segment is most likely to be found in the hydrophobic interior of the folded protein? ОН OY H ZI IZ ONH2 A. Isoleucine B. Threonine C. Glutamine
Consider a recently-synthesized human polypeptide that is 51 amino acids long. How many different amino acid sequences are possible in this polypeptide