Which is not true about the following peptide?
Homework Answers
Request Answer!
We need at least 10 more requests to produce the answer.
0 / 10 have requested this problem solution
The more requests, the faster the answer.
Add Answer to:
Which is not true about the following peptide?
Which is not true about the following peptide?...
Which of the statements about peptide bonds are true? D A tripeptide contains three amino acid...
Which of the statements about peptide bonds are true? D A tripeptide contains three amino acid residues. Peptide bonds are ester linkages. Peptide bond formation is a hydrolysis reaction. O Peptides are polymers of amino acids. Peptide bonds form from nucleophilic attack by an a-carboxyl carbon atom on an electron pair of an a-amino nitrogen atom of another amino acid.
Which of the following is true about the peptide bond. Choose all true statements. The peptide...
Which of the following is true about the peptide bond. Choose all true statements. The peptide bond is polar, the N has a partial negative charge and the C has a partial positive charge. The peptide bond is uncharged. The plane of the peptide bond contains the following atoms: the alpha-carbon atom and CO groups of the first amino acid, the NH group and alpha-carbon of the second amino acid. The peptide bond has no double bond character.
1. Given the following peptide, which of the following statements is true? Question options: a) The...
1. Given the following peptide, which of the following
statements is true?
Question options:
a) The N-terminal residue is leucine.
b)This peptide contains 4 amino acid residues.
c) The peptide contains a total of 6 ionizable groups.
d) The net charge of this peptide at pH 7 is +1 Locate any
peptide bond along the backbone of the given peptide.
e) The bond between the C (of the C=O) and the N (of the N-H) of
a peptide bond has...
I 79) The sequence of a nonapeptide was determined from the following evidence: a. A peptide...
I 79) The sequence of a nonapeptide was determined from the following evidence: a. A peptide is acyclic compound containing a disulfide bridge between two cysteine residues. b. When the disulfide bridge is reduced, peptide has the constitution Asn, Cys2, Gin, Gly, Ile, Leu, Pro, Tyr. Partial hydrolysis of reduced peptide yields seven fragments: Asp-Cys, Ile-Glu, Cys-Tyr, Leu-Gly, Tyr-Ile-Glu, Glu-Asp-Cys, and Cys-Pro-Leu. d. Gly is the C-terminal group. C W What is the amino acid sequence of reduced peptide? What...
1. What amino acids do the following abbreviations stand for? Draw the structure of each. a)...
1. What amino acids do the following abbreviations stand for? Draw the structure of each. a) lle b) Thr c) Gin 2. Name and draw the structures of the amino acids that fit these descriptions: a) Contains an isopropyl group b) Contains a secondary alcohol group 3. Which of the following objects is chiral? a) A pair of scissors b) A comb c) A drinking glass 4. What does the term achiral mean? Give two examples involving organic structures.. 5....
A peptide bond between two amino acids is what type of functional group? Ketone O Ester...
A peptide bond between two amino acids is what type of functional group? Ketone O Ester Amide O Disulfide Aldehyde The tertiary structure of a proteins is NOT held together by which type of bond/interaction? Hydrogen bond Electrostatic interactions Hydrophobic interactions Peptide bond Disulfide bonds
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume...
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume the protein is in solution at physiological pH, and remember to include the amino acids at each end of the chain. A charge may come from the R-group, the N-terminus, and/or the C-terminus. If a residue occurs more than once, include each one in your answer.) List the residues (individual amino acids) that contribute a positive charge: List the residues that contribute a...
26. Which of the following classification does not match the amino acid side chain A) Contains an basic group/ lysi...
26. Which of the following classification does not match the amino acid side chain A) Contains an basic group/ lysine B) It is polar C) Forms disulfide bond/ cysteine D) Forms hydrogen bonds with neighbors/ alanine serine 27. All amino acids found in proteins are L-amino acids EXCEPT the achiral. A) glutamate B) Lysine C) glyeine D) Alamine 28. The plH at which the positive and negative charges of an amino acid balance each ofher is called the A) isotonic...
Please answer all Questions QUESTION 10 2.5 points Save Answer The following is an amino acid...
Please answer all
Questions
QUESTION 10 2.5 points Save Answer The following is an amino acid True False QUESTION 11 2.5 points Save Answer This compound would be a likely component of the lipid bilayer of cell membranes H-C-O нсо H.coi True False QUESTION 12 2 .5 points Save Answer Branched chain amino acids refer to An amino acid capable of forming two amide bonds (i.e., branched polypeptide) O an amino acid with a fatty acid chain O an amino...
Which of the following is true about quaternary structures of proteins? a. It is the three-dimensional...
Which of the following is true about quaternary structures of proteins? a. It is the three-dimensional shape of a protein consisting of a single peptide chain. b. It is the three-dimensional shape of a protein consisting of a multiple peptide chains. c. It is the order of amino acids in the peptide chain. d. It is the number of alpha helices in the peptide chain.
Which of the statements about peptide bonds are true? D A tripeptide contains three amino acid residues. Peptide bonds are ester linkages. Peptide bond formation is a hydrolysis reaction. O Peptides are polymers of amino acids. Peptide bonds form from nucleophilic attack by an a-carboxyl carbon atom on an electron pair of an a-amino nitrogen atom of another amino acid.
1. Given the following peptide, which of the following
statements is true?
Question options:
a) The N-terminal residue is leucine.
b)This peptide contains 4 amino acid residues.
c) The peptide contains a total of 6 ionizable groups.
d) The net charge of this peptide at pH 7 is +1 Locate any
peptide bond along the backbone of the given peptide.
e) The bond between the C (of the C=O) and the N (of the N-H) of
a peptide bond has...
I 79) The sequence of a nonapeptide was determined from the following evidence: a. A peptide is acyclic compound containing a disulfide bridge between two cysteine residues. b. When the disulfide bridge is reduced, peptide has the constitution Asn, Cys2, Gin, Gly, Ile, Leu, Pro, Tyr. Partial hydrolysis of reduced peptide yields seven fragments: Asp-Cys, Ile-Glu, Cys-Tyr, Leu-Gly, Tyr-Ile-Glu, Glu-Asp-Cys, and Cys-Pro-Leu. d. Gly is the C-terminal group. C W What is the amino acid sequence of reduced peptide? What...
1. What amino acids do the following abbreviations stand for? Draw the structure of each. a) lle b) Thr c) Gin 2. Name and draw the structures of the amino acids that fit these descriptions: a) Contains an isopropyl group b) Contains a secondary alcohol group 3. Which of the following objects is chiral? a) A pair of scissors b) A comb c) A drinking glass 4. What does the term achiral mean? Give two examples involving organic structures.. 5....
A peptide bond between two amino acids is what type of functional group? Ketone O Ester Amide O Disulfide Aldehyde The tertiary structure of a proteins is NOT held together by which type of bond/interaction? Hydrogen bond Electrostatic interactions Hydrophobic interactions Peptide bond Disulfide bonds
26. Which of the following classification does not match the amino acid side chain A) Contains an basic group/ lysine B) It is polar C) Forms disulfide bond/ cysteine D) Forms hydrogen bonds with neighbors/ alanine serine 27. All amino acids found in proteins are L-amino acids EXCEPT the achiral. A) glutamate B) Lysine C) glyeine D) Alamine 28. The plH at which the positive and negative charges of an amino acid balance each ofher is called the A) isotonic...
Please answer all
Questions
QUESTION 10 2.5 points Save Answer The following is an amino acid True False QUESTION 11 2.5 points Save Answer This compound would be a likely component of the lipid bilayer of cell membranes H-C-O нсо H.coi True False QUESTION 12 2 .5 points Save Answer Branched chain amino acids refer to An amino acid capable of forming two amide bonds (i.e., branched polypeptide) O an amino acid with a fatty acid chain O an amino...
Which of the following is true about quaternary structures of proteins? a. It is the three-dimensional shape of a protein consisting of a single peptide chain. b. It is the three-dimensional shape of a protein consisting of a multiple peptide chains. c. It is the order of amino acids in the peptide chain. d. It is the number of alpha helices in the peptide chain.
Most questions answered within 3 hours.
-
Industry: Telecommunications in India
Here, you need to discuss the sources of the growth pattern
and...
asked 54 minutes ago -
Hydrobromic acid
dissolves solid iron according to the followiaung reaction:
Fe(s)+2HBr(aq)→
FeBr2(aq)+ H2(g)
Part A. What...
asked 2 hours ago -
Verify the following vector identity in SPHERICAL
COORDINATES.
div(curl(A)) = 0
asked 4 hours ago -
The work function (Φ) for a metal is 7.50×10-19 J.
What is the longest wavelength (nm)...
asked 5 hours ago -
1. Would the following procedural changes cause the
calculated mass percent Ni2+ ion in Ni(NH3)nCl2 to...
asked 6 hours ago -
1. Why does the voltage of the capacitor vary with frequency?
where does this missing voltage...
asked 7 hours ago -
p p please write each step out clearly
3. A manager of a company is considering...
asked 6 hours ago -
On October 1, Ebony Ernst organized Ernst Consulting; on October
3, the owner contributed $83,540 in...
asked 7 hours ago -
A.)As an electron moves through a region of space, its speed
decreases from 9.60 × 106...
asked 8 hours ago -
In java with the netbeans program do:
Through object programming
Create a class "ContadorP", which is...
asked 8 hours ago -
Pattern Corporation acquired all of Science
Company's outstanding stock on January 1, 2016 for $600,000 cash....
asked 8 hours ago -
Here are all accounts Tyler Co. maintains.
Tax expenses $4,750
Common stocks $48,840
SG&A expenses $2,500...
asked 8 hours ago