Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume...
Imagine that you have just isolated a peptide hormone with the
following primary sequence:
MLSCRLQEALAALSKIVLADLGCVTGAPSDPR
(Assume the protein is in solution at physiological pH, and
remember to include the amino acids at each end of the chain. A
charge may come from the R-group, the N-terminus, and/or the
C-terminus. If a residue occurs more than once, include each one in
your answer.)
List the residues (individual amino acids) that contribute a
positive charge:
List the residues that contribute a negative charge:
Which residues can be connected by a disulfide bond? (Only type the
letter.)
What would the NET charge of this peptide be at physiological
pH?
Homework Answers
- residues that contribute positive charges : histidine(H), lysine(K), arginine(R).
- residues that contribute negative charges : aspartic acid(D), glutamic acid(E).
- the residues that can be connected by disulphide bond is cysteine (C).
- net charge : zero
Add Answer to:
Imagine that you have just isolated a peptide hormone with the
following primary sequence:
MLSCRLQEALAALSKIVLADLGCVTGAPSDPR
(Assume...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
You have a peptide whose sequence is secretly known, that you want to analyze. The peptide...
You have a peptide whose sequence is secretly known, that you want to analyze. The peptide sequence is D-M-K-T-L-A-R-S-M-E-I-D-Q You have three reagents that cleave polypeptides, CNBr, chymotrypsin, and trypsin into smaller peptides. If you could purify these peptides and sequence them by Edman, but only get four amino acids. 1) what end of the protein does the Edman reaction cleave residues from? n-terminus or c-terminus 2) what are all the Edman sequences (up to 4 amino acids) of the...
please answer thoroughly and correctly thjs js my last try Vasopressin is a peptide hormone synthesized...
please answer thoroughly and correctly thjs js my last try
Vasopressin is a peptide hormone synthesized by the hypothalamus; in its reduced form it has the structure shown. NH2 HS H H₂N н NH2 SH H NH2 OH Vasopressin NH *H N NH2 This structure is incorrect in that one of the amino acids is shown in the D-configuration, rather than the L. Which one is it? What is the amino acid sequence of this peptide? CYFONCPRG Enter your answer...
help with these please Examine the peptide. Thr-Glu-Pro-Ile-Val-Ala-Pro-Met-Glu-Tyr-Gly-Lys Write the sequence using one-letter abbreviations. sequence: TKPIVAPMEYGK...
help with these please
Examine the peptide. Thr-Glu-Pro-Ile-Val-Ala-Pro-Met-Glu-Tyr-Gly-Lys Write the sequence using one-letter abbreviations. sequence: TKPIVAPMEYGK Estimate the net charge on the peptide at pH 7. charge at pH 7: Estimate the net charge on the peptide at pH 12. Alpha helices are a type of secondary structure in proteins. What is the length of a 23.0 kDa single-stranded a-helical protein segment? Assume a mean residue mass of 110 Da. length: Beta () sheets are a type of secondary structure...
12. Below is a portion of the abstract of a journal article. It describes the isolation,...
12. Below is a portion of the abstract of a journal article. It describes the isolation, purification, and determination of the peptide sequence as well as, the location of each of the disulfide bridges of an antibacterial peptide from the cowpea plant. Give brief and to the point answers to the questions based upon this information. (2 pts) FEBS Joumal 273 (2006) 3489-3497 2006 The Authors Journal compilation2006 FEBS Identification of a cowpea y-thionin with bactericidal activity Octávio L. Franco,...
6. Islet amyloid polypeptide (IAPP), often called amylin, is a peptide hormone that is co-secreted with...
6. Islet amyloid polypeptide (IAPP), often called amylin, is a peptide hormone that is co-secreted with insulin from pancreatic B-cells. In combination, insulin and amylin regulate blood glucose levels. In this signaling process, amylin participates in slowing gastric emptying and promoting satiety, helping to prevent spikes in blood glucose levels. Using your knowledge of protein sequencing and proteomics, answer the questions below related to amylin. A. Islet amyloid polypeptide (IAPP, amylin) is produced by processing of a precursor protein called...
Find the two other segments of the sequence among your classmates that will complete the protein....
Find the two other segments of the sequence among your classmates that will complete the protein. For example if you have a middle segment you will need to find a beginning and an end segment. Write the entire linear order of amino acids in Part 2, Question l in your proforma, (using the single letter amino acid abbreviation). Start with the beginning segment, followed by the middle segment and lastly, the end segment. Indicate the amino (NH2) and carboxyl (COOH)...
In part A, yes you should reconstitute the full-length protein sequence from the fragments. However, you...
In part A, yes you should reconstitute the full-length protein
sequence from the fragments. However, you do not need to write out
the amino acid sequence - you can just provide the order of the
fragment numbers (from either set of fragments). For
example (and this is not the answer), you could say:
"Using the Pro-IAPP fragment set, starting from the N-terminus, the
fragment order is '5-4-6-3-2-1' " and that would fully address the
question.
In part B, the hint...
Q1: You have two short peptides: Peptide A) KVDFSA; Peptide B) IRGTKL a. Write the chemical...
Q1: You have two short peptides: Peptide A) KVDFSA; Peptide B) IRGTKL a. Write the chemical structure of peptide A as it would appear at pH 7. Include all charges and begin from the N-terminus b. determine the net charge on each of the peptides at pH 2, 7, and 11 c. You would now like to separate the two peptides. You decide to use a cation exchange column at pH 7 A cation exchange column is composed of negatively...
1. Given the following peptide, which of the following statements is true? Question options: a) The...
1. Given the following peptide, which of the following
statements is true?
Question options:
a) The N-terminal residue is leucine.
b)This peptide contains 4 amino acid residues.
c) The peptide contains a total of 6 ionizable groups.
d) The net charge of this peptide at pH 7 is +1 Locate any
peptide bond along the backbone of the given peptide.
e) The bond between the C (of the C=O) and the N (of the N-H) of
a peptide bond has...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
please answer thoroughly and correctly thjs js my last try
Vasopressin is a peptide hormone synthesized by the hypothalamus; in its reduced form it has the structure shown. NH2 HS H H₂N н NH2 SH H NH2 OH Vasopressin NH *H N NH2 This structure is incorrect in that one of the amino acids is shown in the D-configuration, rather than the L. Which one is it? What is the amino acid sequence of this peptide? CYFONCPRG Enter your answer...
help with these please
Examine the peptide. Thr-Glu-Pro-Ile-Val-Ala-Pro-Met-Glu-Tyr-Gly-Lys Write the sequence using one-letter abbreviations. sequence: TKPIVAPMEYGK Estimate the net charge on the peptide at pH 7. charge at pH 7: Estimate the net charge on the peptide at pH 12. Alpha helices are a type of secondary structure in proteins. What is the length of a 23.0 kDa single-stranded a-helical protein segment? Assume a mean residue mass of 110 Da. length: Beta () sheets are a type of secondary structure...
12. Below is a portion of the abstract of a journal article. It describes the isolation, purification, and determination of the peptide sequence as well as, the location of each of the disulfide bridges of an antibacterial peptide from the cowpea plant. Give brief and to the point answers to the questions based upon this information. (2 pts) FEBS Joumal 273 (2006) 3489-3497 2006 The Authors Journal compilation2006 FEBS Identification of a cowpea y-thionin with bactericidal activity Octávio L. Franco,...
6. Islet amyloid polypeptide (IAPP), often called amylin, is a peptide hormone that is co-secreted with insulin from pancreatic B-cells. In combination, insulin and amylin regulate blood glucose levels. In this signaling process, amylin participates in slowing gastric emptying and promoting satiety, helping to prevent spikes in blood glucose levels. Using your knowledge of protein sequencing and proteomics, answer the questions below related to amylin. A. Islet amyloid polypeptide (IAPP, amylin) is produced by processing of a precursor protein called...
Find the two other segments of the sequence among your classmates that will complete the protein. For example if you have a middle segment you will need to find a beginning and an end segment. Write the entire linear order of amino acids in Part 2, Question l in your proforma, (using the single letter amino acid abbreviation). Start with the beginning segment, followed by the middle segment and lastly, the end segment. Indicate the amino (NH2) and carboxyl (COOH)...
In part A, yes you should reconstitute the full-length protein
sequence from the fragments. However, you do not need to write out
the amino acid sequence - you can just provide the order of the
fragment numbers (from either set of fragments). For
example (and this is not the answer), you could say:
"Using the Pro-IAPP fragment set, starting from the N-terminus, the
fragment order is '5-4-6-3-2-1' " and that would fully address the
question.
In part B, the hint...
Q1: You have two short peptides: Peptide A) KVDFSA; Peptide B) IRGTKL a. Write the chemical structure of peptide A as it would appear at pH 7. Include all charges and begin from the N-terminus b. determine the net charge on each of the peptides at pH 2, 7, and 11 c. You would now like to separate the two peptides. You decide to use a cation exchange column at pH 7 A cation exchange column is composed of negatively...
1. Given the following peptide, which of the following
statements is true?
Question options:
a) The N-terminal residue is leucine.
b)This peptide contains 4 amino acid residues.
c) The peptide contains a total of 6 ionizable groups.
d) The net charge of this peptide at pH 7 is +1 Locate any
peptide bond along the backbone of the given peptide.
e) The bond between the C (of the C=O) and the N (of the N-H) of
a peptide bond has...
Most questions answered within 3 hours.
-
While rotating the tires on your car you notice a rock [mass =
0.1 Kg] stuck...
asked 1 hour ago -
Using MARS simulator, write MIPS programs according to
the following scenarios: Receive a positive integer number...
asked 3 hours ago -
An object in front of a concave mirror has a real image that is
11.5 cm...
asked 3 hours ago -
Consider the reaction, C3 H8 + O2 --> CO2 + H2O. How many
moles of O2...
asked 5 hours ago -
You and your opponent both roll a fair die. If you both roll the
same number,...
asked 5 hours ago -
In a study of the accuracy of fast food drive-through orders,
Restaurant A had 257 accurate...
asked 5 hours ago -
Identify and describe in detail the four categories of
institutions that could be included in a...
asked 5 hours ago -
In python
class Customer:
def __init__(self, customer_id, last_name, first_name, phone_number, address):
self._customer_id = int(customer_id)
self._last_name =...
asked 6 hours ago -
What is an example of a limitation in implementing a new
ERP system and how it...
asked 5 hours ago -
In a section of 9.7cm of an artery with a radius of 2.6mm there
is a...
asked 6 hours ago -
the two carboxylic acid groups of aspartic acid have different
acidities with pKa values of 2.1...
asked 6 hours ago -
Would CuCO3 aqueous salt combined with calcium chloride
form a solid precipitate? If so, what would...
asked 6 hours ago