This question is relating to protein sequences that have been given in class to be placed in the right order.
I have attempted to answer your question assuming that the question is on Human Insulin hormone after reading the questions.
Answer: Insulin hormone is a short peptide hormone secreted by the beta cells of islet of pancreas and has 51 amino acids in the following sequence.
Signal Peptide -->B chain-->C-Ppetide-->A chain Toatl 110 polypeptides
M1ALWM5RLLPL10LALLA15LWGPD20PAAAF25VNQHL30CGSHL35VEALY40LVCGE45RGFFY50TPKYR55REAED60LQVGQ65VGLGG70GPGAG75SLQPL80ALEGS85LQKRG90IVEQC95CTSIC100SLYQL105ENYCN110
The polypeptide is cleaved at 24th, 55th and 56th and 88th and 89th position to separate the unwanted components leaving behind the Insulin Hormone
In Chain A-21 amino acids -The NH2 terminal is Gly and COOH terminal is Asn
In Chain B-30 amino acids-The NH2 terminal is Phe and COOH terminal is Ala
Find the two other segments of the sequence among your classmates that will complete the protein....
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
QU. 5. You have identified the complete amino acid sequence on protein sequencing techniques. "Y" is composed of 44 amino acids with the po below. No information is available about its genetic sequence. Your task sequence for protein "Y". Assume that the gene sequence is unique in the human 5 BRIEFLY EXPLAIN methodically and accurately how you will decipher the gene seg "Y". (3 POINTS). no acid sequence of a human protein called "Y" using 1.44 amino acids with the...
35. Insulin is a peptide (protein) hormone secreted by B-cells located in the pancreas. To be protein) hormone used to regulate the level of glucose in the bloodstream. It is produced and performed. cated in the pancreas. To better understand how insulin is secreted, the following experiments were a. The mature me mature mRNA for insulin encodes a protein that is 110 amino acids in length. If the genes t is 110 amino acids in length. If the gene is...
Place these events that occur during protein synthesis in the proper sequence - I. II. III. IV. An aminoacyl-tRNA binds to the A site - I. II. III. IV. A peptide bond forms between the new amino acid and a polypeptide chain - I. II. III. IV. ...
In part A, yes you should reconstitute the full-length protein sequence from the fragments. However, you do not need to write out the amino acid sequence - you can just provide the order of the fragment numbers (from either set of fragments). For example (and this is not the answer), you could say: "Using the Pro-IAPP fragment set, starting from the N-terminus, the fragment order is '5-4-6-3-2-1' " and that would fully address the question. In part B, the hint...
Please help with 4-10! DNA, Genes,and Protein Synthesis Activity 13: 2. The bases that interact with each other are called complementary bases. this definition and your answers to 1 complete the following: a. Thiamine (T) is the complementary base of b. Cytosine (C) is the complementary base of c. Adenine (A) is the complementary base of d. Guanine (G) is the complementary base of Based on 3. Shown below is the nucleotide sequence for one strand of a stretch of...
O ACTIVITY 5.4.1 Synthesis of a Protein: A Simulation Activity In this activity, you will be provided with the DNA nucleotide sequence that codes for a hypothetical protein. The code will be provided to you in three fragments. You will have to tran- scribe the code into mRNA, remove an intron segment, and translate the mRNA into the protein. In addition, you will have to identify the beginning fragment the middle fragment, and the end fragment. Sequence A TCTTCCCTCCTAAACGTTCAACCGGTTCTTAATCCGC CGCCAGGGCCCCGCCCCTCAGAAGTTGGT...
1. Amino acids are considered to be either hydrophobic or hydrophilic as described by the relative polarity of their side chain. Consider a folded protein in an aqueous environment; where would the hydrophobic amino acids likely be found? -Tucked away in the middle of the folded protein -Randomly distributed throughout the protein -Exposed on the exterior surface of the folded protein 2. All proteins exhibit a primary, secondary, and tertiary structure, but not all proteins exhibit a quaternary structure. Describe...
Protein kinases can A) Inactivate enzymes by dephosphorylating them B) Activate enzymes by phosphorylating them C) Cleave proteins after Tyr, Ser, or Thr residues D) Contain a catalytic triad to cut peptide bonds Peanut oil contains a high percentage of monounsaturated fatty acids whereas vegetable oil contains a high percentage of polyunsaturated fatty acids. During a cold spell, the peanut oil freezes whereas the vegetable oil remains liquid. Explain why. Predict which one of the following organisms will have the...
Lab #14 Protein Synthesis Introduction Proteins are vital for the survival of an organism. Proteins make enzymes and hormones which control reactions that must take place in the cell to survive.Proteins are made of basic units called amino acids. There are a total of 20 amino acids. Different proteins have different number and/or combination of amino acids. The kind of amino acid that is used when producing the protein depends on the 3-base code (codon) read from the RNA molecule...