Question

vodafone AU 9:00 am 100% Ims.rmit.edu.au Find the two other segments of the sequence among your classmates that will complete the protein. For example if you have a middle segment you will need to find a beginning and an end segment. 1:Write the entire linear order of amino acids in Part 2, Question l in your proforma. (using the single letter amino acid abbreviation). Start with the beginning segment, followed by the middle segment and lastly, the end segment. Indicate the amino (NH2) and carboxyl (COOH) ends of the insulin protein. (5 marks) 2: Number every 5th amino acid in the sequence (write the number above the appropriate amino acid: eg, 5 10 15 etc). So the number 5 goes ON TOP of the fifth amino acid, (not after it). This makes it easier to locate a particular amino acid in the sequence. (1 mark) 3: How many amino acids does this complete insulin protein your proforma. (i mark) 4: Indicate on the complete amino acid sequence (in your proforma) where the enzymes cut the prepro-insulin to remove the signal sequence and C peptide. The locations where the enzymes cut should indicated by a downward pointing arrow above the sequence. Please put this arrow between the two amino acids where these cuts occur. marks) eg. DLA VRT 5: Write out the amino acid sequences of the mature insulin hormone (B and A chains). Write out two separate chains. Do not unite the chains. Please write these out in the proforma. (Remember to remove the signal sequence and C peptide from the original amino acid sequence) (2 marks) 6: How many amino acids are in the B chain?And how many amino acids are in the A chain? Write these figures in your proforma. (2 marks
0 0
Add a comment Improve this question Transcribed image text
Answer #1

This question is relating to protein sequences that have been given in class to be placed in the right order.

I have attempted to answer your question assuming that the question is on Human Insulin hormone after reading the questions.

Answer: Insulin hormone is a short peptide hormone secreted by the beta cells of islet of pancreas and has 51 amino acids in the following sequence.

Signal Peptide -->B chain-->C-Ppetide-->A chain Toatl 110 polypeptides

M1ALWM5RLLPL10LALLA15LWGPD20PAAAF25VNQHL30CGSHL35VEALY40LVCGE45RGFFY50TPKYR55REAED60LQVGQ65VGLGG70GPGAG75SLQPL80ALEGS85LQKRG90IVEQC95CTSIC100SLYQL105ENYCN110

The polypeptide is cleaved at 24th, 55th and 56th and 88th and 89th position to separate the unwanted components leaving behind the Insulin Hormone

A Chain Gly lle Val Glu Gin Cys Cys Ala Ser Val Cys Ser Leu Tyr Gin Leu Glu Asn Tyr Cys Asn Phe Val Asn Gln His Le Cys Gly Se

In Chain A-21 amino acids -The NH2 terminal is Gly and COOH terminal is Asn

In Chain B-30 amino acids-The NH2 terminal is Phe and COOH terminal is Ala

Add a comment
Know the answer?
Add Answer to:
Find the two other segments of the sequence among your classmates that will complete the protein....
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...

    A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...

  • QU. 5. You have identified the complete amino acid sequence on protein sequencing techniques. "Y" is...

    QU. 5. You have identified the complete amino acid sequence on protein sequencing techniques. "Y" is composed of 44 amino acids with the po below. No information is available about its genetic sequence. Your task sequence for protein "Y". Assume that the gene sequence is unique in the human 5 BRIEFLY EXPLAIN methodically and accurately how you will decipher the gene seg "Y". (3 POINTS). no acid sequence of a human protein called "Y" using 1.44 amino acids with the...

  • 35. Insulin is a peptide (protein) hormone secreted by B-cells located in the pancreas. To be...

    35. Insulin is a peptide (protein) hormone secreted by B-cells located in the pancreas. To be protein) hormone used to regulate the level of glucose in the bloodstream. It is produced and performed. cated in the pancreas. To better understand how insulin is secreted, the following experiments were a. The mature me mature mRNA for insulin encodes a protein that is 110 amino acids in length. If the genes t is 110 amino acids in length. If the gene is...

  • Place these events that occur during protein synthesis in the proper sequence       -   ...

    Place these events that occur during protein synthesis in the proper sequence       -       I.       II.       III.       IV.    An aminoacyl-tRNA binds to the A site       -       I.       II.       III.       IV.    A peptide bond forms between the new amino acid and a polypeptide chain       -       I.       II.       III.       IV.   ...

  • In part A, yes you should reconstitute the full-length protein sequence from the fragments. However, you...

    In part A, yes you should reconstitute the full-length protein sequence from the fragments. However, you do not need to write out the amino acid sequence - you can just provide the order of the fragment numbers (from either set of fragments). For example (and this is not the answer), you could say: "Using the Pro-IAPP fragment set, starting from the N-terminus, the fragment order is '5-4-6-3-2-1' " and that would fully address the question. In part B, the hint...

  • Please help with 4-10! DNA, Genes,and Protein Synthesis Activity 13: 2. The bases that interact with each other are called complementary bases. this definition and your answers to 1 complete th...

    Please help with 4-10! DNA, Genes,and Protein Synthesis Activity 13: 2. The bases that interact with each other are called complementary bases. this definition and your answers to 1 complete the following: a. Thiamine (T) is the complementary base of b. Cytosine (C) is the complementary base of c. Adenine (A) is the complementary base of d. Guanine (G) is the complementary base of Based on 3. Shown below is the nucleotide sequence for one strand of a stretch of...

  • O ACTIVITY 5.4.1 Synthesis of a Protein: A Simulation Activity In this activity, you will be...

    O ACTIVITY 5.4.1 Synthesis of a Protein: A Simulation Activity In this activity, you will be provided with the DNA nucleotide sequence that codes for a hypothetical protein. The code will be provided to you in three fragments. You will have to tran- scribe the code into mRNA, remove an intron segment, and translate the mRNA into the protein. In addition, you will have to identify the beginning fragment the middle fragment, and the end fragment. Sequence A TCTTCCCTCCTAAACGTTCAACCGGTTCTTAATCCGC CGCCAGGGCCCCGCCCCTCAGAAGTTGGT...

  • 1. Amino acids are considered to be either hydrophobic or hydrophilic as described by the relative...

    1. Amino acids are considered to be either hydrophobic or hydrophilic as described by the relative polarity of their side chain. Consider a folded protein in an aqueous environment; where would the hydrophobic amino acids likely be found? -Tucked away in the middle of the folded protein -Randomly distributed throughout the protein -Exposed on the exterior surface of the folded protein 2. All proteins exhibit a primary, secondary, and tertiary structure, but not all proteins exhibit a quaternary structure. Describe...

  • Protein kinases can A) Inactivate enzymes by dephosphorylating them B) Activate enzymes by phosphorylating them C)...

    Protein kinases can A) Inactivate enzymes by dephosphorylating them B) Activate enzymes by phosphorylating them C) Cleave proteins after Tyr, Ser, or Thr residues D) Contain a catalytic triad to cut peptide bonds Peanut oil contains a high percentage of monounsaturated fatty acids whereas vegetable oil contains a high percentage of polyunsaturated fatty acids. During a cold spell, the peanut oil freezes whereas the vegetable oil remains liquid. Explain why. Predict which one of the following organisms will have the...

  • Lab #14 Protein Synthesis Introduction Proteins are vital for the survival of an organism. Proteins make...

    Lab #14 Protein Synthesis Introduction Proteins are vital for the survival of an organism. Proteins make enzymes and hormones which control reactions that must take place in the cell to survive.Proteins are made of basic units called amino acids. There are a total of 20 amino acids. Different proteins have different number and/or combination of amino acids. The kind of amino acid that is used when producing the protein depends on the 3-base code (codon) read from the RNA molecule...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT
ADVERTISEMENT