Homework Answers
Request Answer!
We need at least 10 more requests to produce the answer.
0 / 10 have requested this problem solution
The more requests, the faster the answer.
Add Answer to:
Question 1 (0.5 points) Saved Proteins are formed by joining together. carboxylic acids fatty acids amino...
The primary structure of a protein is formed by the condensation of amino acids in a...
The primary structure of a protein is formed by the condensation of amino acids in a certain sequence. Consider the dipeptide formed by the condensation of glycine and tyrosine in Figure 8.31B. a. Draw the structure of the dipeptide that would be formed if the two amino acids condensed in the opposite sequence. b. How are the structures of the dipeptides in Figure 8.31B and your drawing related to each other? B 0 HN-C-0--OH HO H-N-C-C-OH H CHE H OH...
Question 2 1 pts Amino acids are classified by their Rgroup (side chain) carboxylic acid group...
Question 2 1 pts Amino acids are classified by their Rgroup (side chain) carboxylic acid group peptide bond alpha carbon amine group
9. The bond linking together amino acids to form peptides is called a atom of atom...
9. The bond linking together amino acids to form peptides is called a atom of atom of the amine group. bond. This involves a covalent bond linking the the carboxylate group of one amino acid to the 10. Peptides are classi fied according to the number of amino acids linked together. As such, peptides containing 2, 3, and 4 amino acids would be classified as a(n) , and respectively. A peptide containing five or more amino acid is a(n) 11....
Question 5 Bio206 Homework 6 Amino Acids and Proteins Organic Chemistry II Due May 6, 2017 1. Which amino acid is least likely to be found in a natural protein? CH20H NHz CHs IV 2. A pentapeptide has...
Question 5
Bio206 Homework 6 Amino Acids and Proteins Organic Chemistry II Due May 6, 2017 1. Which amino acid is least likely to be found in a natural protein? CH20H NHz CHs IV 2. A pentapeptide has the molecular formula: Asp, Glu, His, Phe, Val. Partial hydrolysis of the pentapeptide gives: Val Asp, Glu His, Phe Val, and Asp Glu. What is the amino acid sequence of the pentapeptide? 3. When the pentapeptide below is heated first with 2,4-dinitrofluorobenzene...
of alanine has a pk of 9.87. What is the 153, The amino group charge on...
of alanine has a pk of 9.87. What is the 153, The amino group charge on that amino group at pH 7.0 145. Which amino acid serves as the first amino acid at the hN terminus of a newly synthesized protein? (B) methionine (A) alanine 9.80. The side chain of that amino acid includes (A) an amine group (C) a carboxylic acid group. (D) an alcohol 154. A certain amino acid has a pl (or pH, isoelectric point) (D) threonine...
QUESTION 42 Protein A is a viral protein of 100 amino acids. Protein B is a...
QUESTION 42 Protein A is a viral protein of 100 amino acids. Protein B is a viral protein of 500 amino acids. Which of the following is true concerning these two proteins? Protein B has more epitopes than protein A Protein A has less chance to be recognized by the host antibodies Protein B can activate more B cell clones than protein A during clonal selection All of the above QUESTION 41 Which one of these statements is true? Neurons...
I need help ASAP pleaseeee it is due in 30mins Question 5 (0.5 points) If you...
I need help ASAP pleaseeee it is due in 30mins
Question 5 (0.5 points) If you added a enzyme to a protein sample in which the polymers were degraded into individual amino acids, what would you expect after adding Biuret reagent? OA) A deep violet purple color would be present B) Enzymes cannot be used to break down proteins C) There would be no reaction and thus no color change D) The color of the solution would reflect the concentration...
Question 1 (1 point) In this lab you will attempt to hydrolyze the triacylglycerols ("fat") found...
Question 1 (1 point) In this lab you will attempt to hydrolyze the triacylglycerols ("fat") found in milk. What are the expected products for this hydrolysis? triacylglcerol and fatty acids fatty acids and glycerol glycerol and water water and triglycerides Question 2 (1 point) In this lab you will attempt to hydrolyze the triacylglycerols ("fat") found in milk. If hydrolysis is successful, what will happen to the pH of the milk solution? pH will increase pH will decrease OpH will...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
i need a study check is 54-60 correct ?? -(1-0-0- IN-CH-0-0- Culo inhibits the formation of...
i need a study check is 54-60 correct ??
-(1-0-0- IN-CH-0-0- Culo inhibits the formation of a complex under the reaction conditions. forms an enzyme-substrate complex that is stable. oms an enzyme-substrate complex after which the product and the enzyme separate. is a system specific to the hydrolysis of complex carbohydrates. This is an enzyme substrate complex that is reaction conditions. - when a patient has accidentally ingested methanol, a physician can order the use of ethanol overwhelm the alcohol...
The primary structure of a protein is formed by the condensation of amino acids in a certain sequence. Consider the dipeptide formed by the condensation of glycine and tyrosine in Figure 8.31B. a. Draw the structure of the dipeptide that would be formed if the two amino acids condensed in the opposite sequence. b. How are the structures of the dipeptides in Figure 8.31B and your drawing related to each other? B 0 HN-C-0--OH HO H-N-C-C-OH H CHE H OH...
Question 2 1 pts Amino acids are classified by their Rgroup (side chain) carboxylic acid group peptide bond alpha carbon amine group
9. The bond linking together amino acids to form peptides is called a atom of atom of the amine group. bond. This involves a covalent bond linking the the carboxylate group of one amino acid to the 10. Peptides are classi fied according to the number of amino acids linked together. As such, peptides containing 2, 3, and 4 amino acids would be classified as a(n) , and respectively. A peptide containing five or more amino acid is a(n) 11....
Question 5
Bio206 Homework 6 Amino Acids and Proteins Organic Chemistry II Due May 6, 2017 1. Which amino acid is least likely to be found in a natural protein? CH20H NHz CHs IV 2. A pentapeptide has the molecular formula: Asp, Glu, His, Phe, Val. Partial hydrolysis of the pentapeptide gives: Val Asp, Glu His, Phe Val, and Asp Glu. What is the amino acid sequence of the pentapeptide? 3. When the pentapeptide below is heated first with 2,4-dinitrofluorobenzene...
of alanine has a pk of 9.87. What is the 153, The amino group charge on that amino group at pH 7.0 145. Which amino acid serves as the first amino acid at the hN terminus of a newly synthesized protein? (B) methionine (A) alanine 9.80. The side chain of that amino acid includes (A) an amine group (C) a carboxylic acid group. (D) an alcohol 154. A certain amino acid has a pl (or pH, isoelectric point) (D) threonine...
QUESTION 42 Protein A is a viral protein of 100 amino acids. Protein B is a viral protein of 500 amino acids. Which of the following is true concerning these two proteins? Protein B has more epitopes than protein A Protein A has less chance to be recognized by the host antibodies Protein B can activate more B cell clones than protein A during clonal selection All of the above QUESTION 41 Which one of these statements is true? Neurons...
I need help ASAP pleaseeee it is due in 30mins
Question 5 (0.5 points) If you added a enzyme to a protein sample in which the polymers were degraded into individual amino acids, what would you expect after adding Biuret reagent? OA) A deep violet purple color would be present B) Enzymes cannot be used to break down proteins C) There would be no reaction and thus no color change D) The color of the solution would reflect the concentration...
Question 1 (1 point) In this lab you will attempt to hydrolyze the triacylglycerols ("fat") found in milk. What are the expected products for this hydrolysis? triacylglcerol and fatty acids fatty acids and glycerol glycerol and water water and triglycerides Question 2 (1 point) In this lab you will attempt to hydrolyze the triacylglycerols ("fat") found in milk. If hydrolysis is successful, what will happen to the pH of the milk solution? pH will increase pH will decrease OpH will...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
i need a study check is 54-60 correct ??
-(1-0-0- IN-CH-0-0- Culo inhibits the formation of a complex under the reaction conditions. forms an enzyme-substrate complex that is stable. oms an enzyme-substrate complex after which the product and the enzyme separate. is a system specific to the hydrolysis of complex carbohydrates. This is an enzyme substrate complex that is reaction conditions. - when a patient has accidentally ingested methanol, a physician can order the use of ethanol overwhelm the alcohol...
Most questions answered within 3 hours.
-
Life Insurance: A life insurance company wants
to estimate the probability that a 40-year-old male will...
asked 6 seconds ago -
Find the maximum of x in the bottom quartile. (Round your answer
to four decimal places.)...
asked 9 minutes ago -
Which of the following computer languages is the easiest to
use?
A. Assembly language B. First-generation...
asked 3 minutes ago -
Suppose the number of patients per week that visit a health
center follows a Poisson distribution...
asked 5 minutes ago -
A string fixed at both ends is 6.8 m long and has a mass of
0.026...
asked 8 minutes ago -
If there’s an f value of 1 and a critical value of 3.68 do i
reject...
asked 25 minutes ago -
A cannon fires a cannonball from the top of a wall at a speed of
35.16...
asked 20 minutes ago -
in a study of HR leaders in 1000 organizations, what
percentage reported they belonged to the...
asked 22 minutes ago -
sketch a molecular orbital diagram (MO) for Li2 and
C2. How do you find the bond...
asked 25 minutes ago -
Trace amounts of
sulfur (S) in coal are burned in the presence of diatomic oxygen
(O2)...
asked 31 minutes ago -
Diatomic iodine [I2] decomposes at high temperature to form I
atoms according to the reaction: I2(g)⇌2I(g),...
asked 34 minutes ago -
Hello:
Need help with this program. In JavaScript please
// Assume hot dogs come in packages...
asked 40 minutes ago