Question

Protein structures are expressed in terms of amino acid seguence, the short-term repeating pattern, the long term bend and fo
0 0
Add a comment Improve this question Transcribed image text
Answer #1

Ans is true to support this statement you attached information will be useful .• Primary structure: the amino acid sequence. A protein is a polyamide. • Secondary structure: regularly repeating local stru

Add a comment
Know the answer?
Add Answer to:
Protein structures are expressed in terms of amino acid seguence, the short-term repeating pattern, the long...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • Since the secondary structure of a protein results from hydrogen bonding between components shared by all amino acids

     Distinguish between the different levels of protein structure, including primary, secondary, tertiary, and quaternary Question Is the following statement true? If not, explain why not: Since the secondary structure of a protein results from hydrogen bonding between components shared by all amino acids (a hydrogen on an amide N on one amino acid interacts with an oxygen on the carbonyl of another amino acid), the secondary structure does not depend on the specific amino acid groups (the R-groups) in the amino acid chain. Select...

  • 6.) Provide short answers for the questions about protein structure below: a.) True or False, amino...

    6.) Provide short answers for the questions about protein structure below: a.) True or False, amino acid sequence defines the native structure of protein. b.) What is the main type of bonding responsible for stabilizing the secondary structure of proteins? c.) Briefly discuss the thermodynamics of protein folding into its native 3D structure. Is this process enthalpy driven or entropy driven? d.) Give an example of 2 major secondary structural motifs found in polypeptides. Do any of these motifs appear...

  • A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...

    A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...

  • For this assignment, we will consider a protein expressed in the liver of an African cheetah...

    For this assignment, we will consider a protein expressed in the liver of an African cheetah (Acinonyx jubatus). Biochemists determined that this protein is involved in the production of glycogen. In a stunning announcement, a snowboarder in Antarctica claims to have found a new species of cheetah that is able to survive freezing temperatures and a long, dark winter. The snowboarder described a slow, fat, white-furred cheetah that may be related to the African cheetah. Scientists isolated a fragment of...

  • Question 10 (1 point) Identify the amino acid below that may be at its isoelectronic point:...

    Question 10 (1 point) Identify the amino acid below that may be at its isoelectronic point: HgN* - cH-c-0' -*-Y_I_. 9 HN --cH-c-0 -- HgN+ -cH-c-0' - CH, I HN* --CH-c-0' -8_6_6_5_! +NH3| Previous Page Next Page Page 10 of 11 Question 11 (1 point) Which of the following will produce yellow products in a Xanthroproteic test? o Tyr Oval O lys Asp Previous Page Next Page Page 11 of 11 Question 9 (1 point) What happens when the pH...

  • 20. Protein amino acid side chains can hydrogen bond in the major groove of DNA, and...

    20. Protein amino acid side chains can hydrogen bond in the major groove of DNA, and discriminate between each of the four possible base pairs. In which one of the following groups of amino acids can all three members potentially be used in such DNA-protein recognition? A) Ala, Asn, Glu B) Arg. Gin, Leu C) Asn, Gin, Trp D) Asn, Glu, Lys E) Glu, Lys, Pro 21. Compared with DNA polymerase, reverse transcriptase: A) does not require a primer to...

  • 2. Types of short-term bonds Short-term debt securities have a maturity of one year or less....

    2. Types of short-term bonds Short-term debt securities have a maturity of one year or less. The characteristics of the debt securities will depend upon the capital n borrower and the investment needs of the lender. In the following table, identify the term that best matches each type of short-term d being described Definit Term Tiger Telecommunications Company needs to borrow $1 million overnight and is willing to secure the loan with a portfolio of securities that the borrower will...

  • please help me type my introduction for my lab report. thank you!! INTRODUCTION In this section,...

    please help me type my introduction for my lab report. thank you!! INTRODUCTION In this section, you will introduce the experiment by explaining generally what you did and why you did it. This section usually starts with an examination of the literature through a library search to inform the reader about work already done on this topic. If you have never done a bibliographic database search for scientific journal articles, then you are not yet a biological sciences major (note:...

  • SLdtus QUESTION 1 Because short-ter m interest rates are much more volatile than long-term rates, you...

    SLdtus QUESTION 1 Because short-ter m interest rates are much more volatile than long-term rates, you would, in the real world, generally be subject to True QUESTION 2 is a multiple of $1,000. The issuer wil make payments of 6% of A 20-year bond with a 6% coupon rate can have a par the par value each year, generally with one-half of the annual amount paid each 6 months. Bonds may include a si that some of the bonds must...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT
ADVERTISEMENT