A protein consists of 300 amino acids. How many bases will be necessary in the processed...
Homework Answers
1 amino acid = 3 bases
300 amino acids = 300 × 3 = 900 bases
If we consider a stop codon too, than after 900 bases, a stop codon must be present to terminate protein synthesis. So, total number of bases will be 903.
Please rate.
Add Answer to:
A protein consists of 300 amino acids.
How many bases will be necessary in the processed...
Question 8 2.5 pts If a protein (polypeptide) is composed of 210 amino acids, how many...
Question 8 2.5 pts If a protein (polypeptide) is composed of 210 amino acids, how many mRNA codons would be required? Question 9 2.5 pts If a protein (polypeptide) is composed of 210 amino acids, how many mRNA ribonucleotides would be required?
QUESTION 29 How long would a mRNA coding for a protein with 106 amino acids be...
QUESTION 29 How long would a mRNA coding for a protein with 106 amino acids be if it had 5' and 3' UTRs of 30 bases each? (Assume stop codon is part of the last exon)
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
Interrupted coding sequences include long sequences of bases that do NOT code for amino acids. These...
Interrupted coding sequences include long sequences of bases that do NOT code for amino acids. These noncoding sequences, called ________, are found in ________ cells. exons; prokaryotic introns; prokaryotic exons; eukaryotic introns; eukaryotic none of these are correct
If the mass of a protein is 15070 g/mol, approximately how many amino acids does it...
If the mass of a protein is 15070 g/mol, approximately how many amino acids does it contain? (assume there are no other protein modifications) please provide formulas and explanation. thank you
How many translocations will occur for a protein that contains 80 amino acids?
How many translocations will occur for a protein that contains 80 amino acids?
How are the correct amino acids brought to the rib... How are the corect amino acids...
How are the correct amino acids brought to the rib... How are the corect amino acids brought to the ribosomes for protein synthesis? The amino acids are synthesized directly at the ribosomes by the hydrolysis of dietary protein. OAmino acids are carried in the interior of the DNA double helix, then carried to the ribosomes. OAcetyl-CoA carries the amino acids that match the codon on DNA. O Transfer RNA molecules, whose anticodon loop contains the complementary sequence of an MRNA...
if the translated exons of the LDLR gene are 2580 bases, how many amino acids would...
if the translated exons of the LDLR gene are 2580 bases, how many amino acids would this be?
You are studying an interesting protein in nematode worms that is 100 amino acids in length....
You are studying an interesting protein in nematode worms that is 100 amino acids in length. Of particular interest is the fact that the last seven amino acids are all tryptophan (codons 94 through 100). Draw here the mRNA sequence for codons 94-100: Draw here the sequence of the DNA strand RNA polymerase used as its template (show 5' 3' polarity): You mutagenize the wild type worm. Assume for the next questions you are able to isolate both normal and...
Please help with 4-10! DNA, Genes,and Protein Synthesis Activity 13: 2. The bases that interact with each other are called complementary bases. this definition and your answers to 1 complete th...
Please help with 4-10!
DNA, Genes,and Protein Synthesis Activity 13: 2. The bases that interact with each other are called complementary bases. this definition and your answers to 1 complete the following: a. Thiamine (T) is the complementary base of b. Cytosine (C) is the complementary base of c. Adenine (A) is the complementary base of d. Guanine (G) is the complementary base of Based on 3. Shown below is the nucleotide sequence for one strand of a stretch of...
Question 8 2.5 pts If a protein (polypeptide) is composed of 210 amino acids, how many mRNA codons would be required? Question 9 2.5 pts If a protein (polypeptide) is composed of 210 amino acids, how many mRNA ribonucleotides would be required?
QUESTION 29 How long would a mRNA coding for a protein with 106 amino acids be if it had 5' and 3' UTRs of 30 bases each? (Assume stop codon is part of the last exon)
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
How are the correct amino acids brought to the rib... How are the corect amino acids brought to the ribosomes for protein synthesis? The amino acids are synthesized directly at the ribosomes by the hydrolysis of dietary protein. OAmino acids are carried in the interior of the DNA double helix, then carried to the ribosomes. OAcetyl-CoA carries the amino acids that match the codon on DNA. O Transfer RNA molecules, whose anticodon loop contains the complementary sequence of an MRNA...
You are studying an interesting protein in nematode worms that is 100 amino acids in length. Of particular interest is the fact that the last seven amino acids are all tryptophan (codons 94 through 100). Draw here the mRNA sequence for codons 94-100: Draw here the sequence of the DNA strand RNA polymerase used as its template (show 5' 3' polarity): You mutagenize the wild type worm. Assume for the next questions you are able to isolate both normal and...
Please help with 4-10!
DNA, Genes,and Protein Synthesis Activity 13: 2. The bases that interact with each other are called complementary bases. this definition and your answers to 1 complete the following: a. Thiamine (T) is the complementary base of b. Cytosine (C) is the complementary base of c. Adenine (A) is the complementary base of d. Guanine (G) is the complementary base of Based on 3. Shown below is the nucleotide sequence for one strand of a stretch of...
Most questions answered within 3 hours.
-
Write a program to solve the Josephus problem, with the following
modification:
Sample Input:
./a.out n...
asked 5 minutes ago -
At the start of a CD it is spinning at a rate of 525 rpm
(revolutions...
asked 41 minutes ago -
4. Without doing any calculations, predict whether the observed
∆T would increase, decrease or remain the...
asked 1 hour ago -
Based on the range, which of the following sets of scores has
the greatest variability? 3,...
asked 3 hours ago -
Ripples in a pond travel at a velocity of 3 m/s with one peak
passing a...
asked 2 hours ago -
A man stands on the roof of a building of height 13.0 mm and
throws a...
asked 2 hours ago -
The extent to which assets are financed by borrowed funds and
other liabilities is indicated by:...
asked 4 hours ago -
Explain in detail
Germany is the fifth largest economy
explain what goods and services Germany specializes...
asked 4 hours ago -
The density of platinum is 21.45 g/mL. If a cube of platinum
with a mass of...
asked 4 hours ago -
Accounts Receivable
Sales
A/R Posting
Extended Sales Invoice
Packing Slip
Compare invoice to packing slip 2...
asked 4 hours ago -
Michaella, age 23, is a full-time law student and is claimed by
her parents as a...
asked 4 hours ago -
Why are polymers not typically casted into products?
asked 4 hours ago