We need at least 10 more requests to produce the answer.
0 / 10 have requested this problem solution
The more requests, the faster the answer.
Based on the peptide YDCM, which residues are determined via Sanger degradation? Y only M only...
Part A Based on the peptide YDCM, which residues are determined via Sanger degradation? Y only O Monly D and C all of them
Part A Based on the peptide YDCM, which residues are determined via Edman degradation? Y only M only D and C all of them Submit Request Answer ovide Feedback
Based on the peptide YDCM, which residues are determined via Edman degradation? Item 2 Part A Based on the peptide YDCM, which residues are determined via Fdman degradation? Y only Monly OD and o all of them
Based on the peptide YDCM, which residues are determined via Edman degradation? Y only OM only OD and C all of them Submit Request Answer
The peptide bond in proteins is A. only found between proline residues. B. usually cis unl ess proline is the next amino acid. C. usually trans unless proline is the next amino acid. D. is planar because of steric hinderance. E. defines one of the angles used in the Ramachandran plot.
You have a peptide whose sequence is secretly known, that you want to analyze. The peptide sequence is D-M-K-T-L-A-R-S-M-E-I-D-Q You have three reagents that cleave polypeptides, CNBr, chymotrypsin, and trypsin into smaller peptides. If you could purify these peptides and sequence them by Edman, but only get four amino acids. 1) what end of the protein does the Edman reaction cleave residues from? n-terminus or c-terminus 2) what are all the Edman sequences (up to 4 amino acids) of the...
1. Explain why polyaspartatic acid (a peptide containing only aspartic acid residues) does NOT form an alpha helix at pH 7.0 but can at pH 2. 6. 2. What kind of non-covalent interaction would the following pairs of amino acids have in the three dimensional structure of a protein at pH 7.0? a) His-Asp b) Tyr-Asp c) Val-Leu d) Trp-Gln 3. Explain how the difference in structure of hemoglobin and myoglobin contribute to their different functions.
1. Given the following peptide, which of the following statements is true? Question options: a) The N-terminal residue is leucine. b)This peptide contains 4 amino acid residues. c) The peptide contains a total of 6 ionizable groups. d) The net charge of this peptide at pH 7 is +1 Locate any peptide bond along the backbone of the given peptide. e) The bond between the C (of the C=O) and the N (of the N-H) of a peptide bond has...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
38,39 38. Which of the lanes in the gel below would represent an "uninduced" sample? M, 1 23 456 78 A) 1 B) C)3 D) 4 E) 5 2 39. lodoacetamides, maleimides, benzyl halides, and bromomethyl ketones can all be used to modify the residues group on A) amino; basic B) phenyl; Tyr and Trp C) carboxyl; acidic D) sulfhydryl; Cys E) hydroxyl; Ser and Tyr 40. Which statement about intrinsically disordered proteins is TRUE? A) B) C) They contain...