Homework Answers
17), When the tryptophan is available, definitely the transcriptional output from the trp operon would be always very low
So, the correct answer is option (B).- Very low.
20) The correct answer is option (A) - Auxotrophs.
19) when the addition of phosphate groups to histone proteins would causes the DNA to take on make of a heterochromatin form.
so option (B) is the correct answer.
Add Answer to:
all of them please
Question 17 (1 point) If there is lots of tryptophan available, the...
allll pleas Question 14 (1 point) Eukaryotes modify a primary RNA transcript to generate a final...
allll pleas
Question 14 (1 point) Eukaryotes modify a primary RNA transcript to generate a final mRNA product. Which of the following modifications is something that occurs to eukaryotic RNA (which one is correct): OA) removing exons from the transcript B) adding introns into the transcript C) adding a poly(A) tail to the transcript by poly(A) polymerase OD) adding start codons to the transcript after its synthesis E) removing a 5' cap from the transcript Question 18 (1 point) Origins,...
all them please Question 1 (1 point) Given the following information: parental phenotypes in the progeny...
all them please
Question 1 (1 point) Given the following information: parental phenotypes in the progeny are a, b c, and a+, b+, C+, and the double recombinant phenotypes are a+, b, C+ and a, b+, c what is the gene order? A) b--a-- B) a--b-c C) a--C--b ហា Question 5 (1 point) What embryonic event gives rise to calico cats? OA) Y inactivation B) x inactivation C) chromosomal non-disjunction D) meiosis Question 3 (1 point) Two parents without sickle...
alllll them please all To MOST readily demonstrate transformation of bacteria in the laboratory one could...
alllll them please all
To MOST readily demonstrate transformation of bacteria in the laboratory one could extract DNA from: A) his cells and add the DNA to his cells, then grow the cells on plates with histidine B) hist cells and add the DNA to his cells, then grow the cells on plates without histidine C) lac" cells and add the DNA to lact cells, then grow the cells on plates without histidine D) amp cells and add the DNA...
all them please Question 23 (1 point) The A and B alleles in ABO blood types...
all them please
Question 23 (1 point) The A and B alleles in ABO blood types can give rise to an individual that is blog type AB. This specific blood type is an example of: A) multiple alleles B) epistasis C) codominance D) partial dominance Imagine the gene encoding the lac repressor was mutated so that lactose (more technically allolactose) no longer bound to the repressor. However, the lac repressor was still capable of binding DNA at the operator sequence....
please help with these. if you answer all of them I'll be sure to give a...
please help with these. if you answer all of them I'll
be sure to give a thumbs up.
please explain them so I can understand them, especially 28 and 26.
thanks!
13. What would be the MOST likely effect of mutating the consensus sequence found at the 5' splice site of an intron? 1. A longer than normal mRNA would be produced. 2. A shorter than normal protein would be produced. 3. A longer than normal DNA would be produced....
need to know if correct 44 F Nonsense-mediated mRNA decay refers to the degradation of introns...
need to know if correct
44 F Nonsense-mediated mRNA decay refers to the degradation of introns after splicing 45. Exon skipping and cryptic splice-site selection are two types of splicing errors. 46. Transcription activators can promote nucleosome remodeling by recruiting histone modifying enzymes. 47. RNA polymerase Il terminates transcription precisely at the AAUAAA 48. During protein translation, Kozak consensus sequences are required for termination 49. In regards to transcription, DNA tooping refers to the removal of DNA looped around histone...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
one correct answer Question 12 (1 point) What are the trans acting factors that control transcription...
one
correct answer
Question 12 (1 point) What are the trans acting factors that control transcription in bacterial genes? O cap, start codon, stop codon. enhancers, silencers, operator, promoter, polyadenylation signal. 5 prime end of RNA, GU-splice site, branch point-A, AG-splice site, polyadenylation signal. O repressors, activators, cap, start codon, stop codon. O promoters, GU-splice site, branch point-A, AG-splice site, polyadenylation signal. enhancers, silencers, promoters, polyadenylation signal. repressors, activators. attenuators, Shine-Dalgarno sequence, start codon, stop codon attenuators, activator binding site,...
What does the 5 prime cap on the mature mRNA consist of? (Choose all that apply)...
What does the 5 prime cap on the mature mRNA consist of? (Choose all that apply) cap proteins backwards, methylated G nucleotide polyA tail ribosome QUESTION 7 Which DNA regions are necessary to specify removal of an intron? (choose all that apply) cleavage site branch point 5' splice site 3' splice site U-rich sequence QUESTION 9 Which of the following can permit a single gene to produce several different proteins? (choose all that apply) multiple 5' capping sites alternative splicing...
QUESTION 1 MC. Which of the following disease conditions might NOT be treatable by RNAI? a....
QUESTION 1 MC. Which of the following disease conditions might NOT be treatable by RNAI? a. arthritis b. Cancer caused by tumor suppressor gene mutation c. macular degeneration d. cancer caused by oncogen mutation S 5 QUESTION 2 MC. What is the molecular cause of male courtship behavior in fruit flies? a. Alternative splicing of the fruitless transcript b. RNA editing of the fruitless transcript C. Alternative sequence of the fruitless DNA d. Alternative 3' cleavage and polyadenylation of fruitless...
allll pleas
Question 14 (1 point) Eukaryotes modify a primary RNA transcript to generate a final mRNA product. Which of the following modifications is something that occurs to eukaryotic RNA (which one is correct): OA) removing exons from the transcript B) adding introns into the transcript C) adding a poly(A) tail to the transcript by poly(A) polymerase OD) adding start codons to the transcript after its synthesis E) removing a 5' cap from the transcript Question 18 (1 point) Origins,...
all them please
Question 1 (1 point) Given the following information: parental phenotypes in the progeny are a, b c, and a+, b+, C+, and the double recombinant phenotypes are a+, b, C+ and a, b+, c what is the gene order? A) b--a-- B) a--b-c C) a--C--b ហា Question 5 (1 point) What embryonic event gives rise to calico cats? OA) Y inactivation B) x inactivation C) chromosomal non-disjunction D) meiosis Question 3 (1 point) Two parents without sickle...
alllll them please all
To MOST readily demonstrate transformation of bacteria in the laboratory one could extract DNA from: A) his cells and add the DNA to his cells, then grow the cells on plates with histidine B) hist cells and add the DNA to his cells, then grow the cells on plates without histidine C) lac" cells and add the DNA to lact cells, then grow the cells on plates without histidine D) amp cells and add the DNA...
all them please
Question 23 (1 point) The A and B alleles in ABO blood types can give rise to an individual that is blog type AB. This specific blood type is an example of: A) multiple alleles B) epistasis C) codominance D) partial dominance Imagine the gene encoding the lac repressor was mutated so that lactose (more technically allolactose) no longer bound to the repressor. However, the lac repressor was still capable of binding DNA at the operator sequence....
please help with these. if you answer all of them I'll
be sure to give a thumbs up.
please explain them so I can understand them, especially 28 and 26.
thanks!
13. What would be the MOST likely effect of mutating the consensus sequence found at the 5' splice site of an intron? 1. A longer than normal mRNA would be produced. 2. A shorter than normal protein would be produced. 3. A longer than normal DNA would be produced....
need to know if correct
44 F Nonsense-mediated mRNA decay refers to the degradation of introns after splicing 45. Exon skipping and cryptic splice-site selection are two types of splicing errors. 46. Transcription activators can promote nucleosome remodeling by recruiting histone modifying enzymes. 47. RNA polymerase Il terminates transcription precisely at the AAUAAA 48. During protein translation, Kozak consensus sequences are required for termination 49. In regards to transcription, DNA tooping refers to the removal of DNA looped around histone...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
one
correct answer
Question 12 (1 point) What are the trans acting factors that control transcription in bacterial genes? O cap, start codon, stop codon. enhancers, silencers, operator, promoter, polyadenylation signal. 5 prime end of RNA, GU-splice site, branch point-A, AG-splice site, polyadenylation signal. O repressors, activators, cap, start codon, stop codon. O promoters, GU-splice site, branch point-A, AG-splice site, polyadenylation signal. enhancers, silencers, promoters, polyadenylation signal. repressors, activators. attenuators, Shine-Dalgarno sequence, start codon, stop codon attenuators, activator binding site,...
What does the 5 prime cap on the mature mRNA consist of? (Choose all that apply) cap proteins backwards, methylated G nucleotide polyA tail ribosome QUESTION 7 Which DNA regions are necessary to specify removal of an intron? (choose all that apply) cleavage site branch point 5' splice site 3' splice site U-rich sequence QUESTION 9 Which of the following can permit a single gene to produce several different proteins? (choose all that apply) multiple 5' capping sites alternative splicing...
QUESTION 1 MC. Which of the following disease conditions might NOT be treatable by RNAI? a. arthritis b. Cancer caused by tumor suppressor gene mutation c. macular degeneration d. cancer caused by oncogen mutation S 5 QUESTION 2 MC. What is the molecular cause of male courtship behavior in fruit flies? a. Alternative splicing of the fruitless transcript b. RNA editing of the fruitless transcript C. Alternative sequence of the fruitless DNA d. Alternative 3' cleavage and polyadenylation of fruitless...
Most questions answered within 3 hours.
-
Please help me with FLOWCHART and UML diagram for class,
thank you!
#include <iostream>
#include <fstream>...
asked 6 minutes ago -
3. Describe the “logic circuit” of the Lac operon. Which
proteins are bound or not to...
asked 7 minutes ago -
Ayesha’s adjusted gross income is $60,000 in 2019. She donated a
piece of artwork with a...
asked 14 minutes ago -
For Dijkstra’s shortest path algorithm:
a. Give the Big-O time for Dijkstra’s shortest path algorithm
and...
asked 26 minutes ago -
Phosphorus violates the 'octet rule' in biological molecules,
forming more covalent bonds than expected based on...
asked 29 minutes ago -
A 1.3 eV electron has a 10-4 probability of tunneling
through a 2.4 eV potential barrier....
asked 48 minutes ago -
What is the one ingredient that is common to being successful
with all stakeholders?
profit
trust...
asked 47 minutes ago -
Write an assembly language 32 bit program that reads in lines of
text by a .txt...
asked 49 minutes ago -
what is the density ( in g/L) of hydrogen gas at 29 degrees C and a...
asked 58 minutes ago -
5-6. You are considering three investment alternatives for some
spare cash: Old Reliable Corporation stock (A1),...
asked 50 minutes ago -
Problem 16-02
Receivables Investment
Medwig Corporation has a DSO of 45 days. The company averages
$7,250...
asked 1 hour ago -
Mr. Brown hired Lowe's Maintenance Services Limited to repair
and paint the exterior wall of his...
asked 1 hour ago