We need at least 10 more requests to produce the answer.
0 / 10 have requested this problem solution
The more requests, the faster the answer.
2. (7 pts) What is the sequence of the following HEXAPEPTIDE? *PROVIDE WORK/ANSWER for B-F! (Use...
(7 pts) What is the sequence of the following HEXAPEPTIDE? *PROVIDE WORK/ANSWER for B-F! (Use deductive reasoning) Observations from Sequencing Experiments: A. The Sequence contains the following amino acids: Y, R, M, K, G, D B. Reaction with 1-fluoro-2,4-dinitrobenzene yielded DNP-G. ___ ___ ___ ____ ___ ___ y = 0.058x + 0.0081 y = 0.2711x + 0.0105 -0.02 0 0.02 0.04 0.06 0.08 0.1 0.12 0.14 -0.2 -0.1 0 0.1 0.2 0.3 0.4 0.5 Velocity ( mM/min) -1 [S] mM-1...
Deduce the sequence of a heptapeptide that contains the amino acids Met, Gln, Phe, Leu, Cys, Val, and Arg, from the following experimental data. Edman degradation cleaves Cys from the heptapeptide, and carboxypeptidase forms Gln and a hexapeptide. Treatment of the heptapeptide with chymotrypsin forms a hexapeptide and a single amino acid. Treatment of the heptapeptide with trypsin forms a pentapeptide and a dipeptide. Partial hydrolysis forms Gln, Cys, Phe, and the tripeptides Leu-Met-Val and Met-Val-Arg. Be sure to answer...
1. Partial hydrolysis of lysozyme yielded an octapeptide that was later identified as the N-terminal segment of the protein. From the following information, determine the sequence of this octapeptide. a. The following amino acids were identified after complete hydrolysis of the octapeptide: Arginine (Arg) Glycine (Gly) Phenylalanine (Phe) Cysteine (Cys) Leucine (Leu) Valine (Val) Glutamic Acid (Glu) Lysine (Lys) b. Treatment of the octapeptide with dinitroflurobenzene (Sanger reagent) followed by complete hydrolysis gave lysine (Lys) labeled with two dinitrophenyl (DNP) groups. c. Treatment of the octapeptide with trypsin gave lysine...
7. A peptide was isolated from sheep hypothalamus and subjected to sequence analysis. The experimental data are as follows. Deduce the amino acid sequence from this data. a. Composition (2Ala, 2Gly, Thr, Phe, Lys, His, Ser, Trp, Arg, Val) b. Reaction of dinitrofluorobenzene with the intact peptide yielded DNP-Thr. A brief treatment with carboxypeptidase a yielded glycine. c. Trypsin digestion yielded three fragments: i. Phe, Thr, Ala, Lys ii. Gly, Val iii. Trp, His, Ser, Gly, Arg, Ala Treatment of...
Need help with #2 Clearly provide the 3-letter symbol for the correct sequence of cach amino acid in each of listings of the amino acids in the peptide or in any fragments are simply listed in alphabetical order. A subscriptive the number of that amino acid. Use parentheses to incorporate the unknown amino acids after each treatment 1. A five amino acid peptide contains: Arg. Glu, His, Phe, and Ser This peptide yields the following results when broken down into...
biochemistry please show your work 2. A mutant form of polypeptide hormone angiotensin II has the amino acid composition: Ile, Arg, Met, Leu, Phe, Asp, Tyr, and Val. The following observations are made: 1) Treatment with trypsin yields a dipeptide containing Asp and Arg, and a hexapeptide with all the rest. 2) Cyanogen bromide yields a dipeptide containing Phe and Leu and a hexapeptide containing all the rest. 3) Chymotrypsin cleaves the hormone into two tetrapeptides of composition: Val, Tyr,...
I need someone to help explain this to me please in great detail! Explain it to me very simply. thank you! 31) A nonapeptide was determined to have the following amino acid composition: (Lys)2, (Gly)2, (Phe) 2, His, Leu, Met. The following are possible sequences for the peptide. A) G-F-K-K-G-L-M -F-H B) H-L-G-K-K-F-F-G-M C) H-L-F-G-K-K-F-M -G D) H-F-L-G-K-K-F-M-G E) M-L-F-K-F-G-G-K-H The following observations were made during sequence determination. (Hint: FDNB reacts with N-terminal amino groups and specificities of proteases listed...
Yassmeen is a starting Biochemist. A sequence is required. The information that Yassmeen has is as follows: A.) The Peptide is composed of 18 Amino Acids. They are: [A-1; C-2; D-1; F-2; G-2; K-1; L-1; N-2; S-1; T-1; V-1; Y-1; W-1]. B.) Treatment of the Peptide DNFB gave the following adducts: --8-0-y -N-C-C-oH I H Nar C.) Treatment of the intact peptide with Carboxypeptidase "C" gave. "N" D.) Treatment of the intact Peptide with "Elastase" gave the following: 1.) T-A;...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
2. hypothesize the best conditions (pH and temperature) under which the enzyme chymotrypsin functions with an appropriate reference. also, hypothesize what will occur in the presence of an inhibitor and the type of inhibition. EXPERIMENT 5: ENZYME ACTIVITY WITH a-CHYMOTRYPSIN Prelab Assignment 1. Prepare a flow chart, covering one half of the experimental work (either part A and C if your lab bench is on the window side of the lab or part B and D if your locker is...