Question

(7 pts) What is the sequence of the following HEXAPEPTIDE? *PROVIDE WORK/ANSWER for B-F! (Use deductive...

(7 pts) What is the sequence of the following HEXAPEPTIDE? *PROVIDE WORK/ANSWER for B-F! (Use deductive reasoning) Observations from Sequencing Experiments: A. The Sequence contains the following amino acids: Y, R, M, K, G, D B. Reaction with 1-fluoro-2,4-dinitrobenzene yielded DNP-G. ___ ___ ___ ____ ___ ___ y = 0.058x + 0.0081 y = 0.2711x + 0.0105 -0.02 0 0.02 0.04 0.06 0.08 0.1 0.12 0.14 -0.2 -0.1 0 0.1 0.2 0.3 0.4 0.5 Velocity ( mM/min) -1 [S] mM-1 Lineweaver-Burk No Inhibitor With Inhibitor Linear (No Inhibitor) Linear (With Inhibitor) 2 C. Treatment with chymotrypsin yielded two tripeptides. ___ ___ ___ ____ ___ ___ D. Treatment with trypsin yielded three dipeptides. ___ ___ ___ ____ ___ ___ E. Treatment with carboxypeptidase yielded methionine. ___ ___ ___ ____ ___ ___ F. N-terminal sequencing of one of the chymotrypsin-produced tripeptides yielded DNP-K ___ ___ ___ ____ ___ ___ Explanation and summary of protein sequencing techniques • 1-fluoro-2,4, dinitrobenzene (DNFB) is used to identify N-terminal amino acid of a peptide, and provides the following product: DNP-AA (where AA= the N-terminal amino acid of the peptide). • Trypsin is an enzyme that cleaves a peptide at the C-terminal side of R and K. • Chymotrypsin is an enzyme that cleaves a peptide at the C-terminal side of F, Y and W. • Carboxypeptidase is an enzyme that cleaves off the C-terminal amino acid of any peptide. THE HEXAPEPTIDE SEQUENCE: ???

0 0
Add a comment Improve this question Transcribed image text
Answer #1

G-R-Y-K-D-M

B). G is the N-terminal amino acid as the reaction with with 1-fluoro-2,4-dinitrobenzene yielded DNP-G. DNP treatment cleaves off the N-terminal amino acid.

C). Treatment with chymotrypsin yielded two tripeptides: G-R-Y and K-D-M.

Chymotrypsin cleaves a peptide at the C-terminal side of F, Y and W.

D). Treatment with trypsin yielded three dipeptides: G-R, Y-K, and D-M.

Trypsin cleaves a peptide at the C-terminal side of R and K.

E). M is the C-terminal amino acid as the treatment with carboxypeptidase yielded methionine.

F). N-terminal sequencing of one of the chymotrypsin-produced tripeptides yielded DNP-K.

One of the tripeptides produced by chymotrypsin treatment is K-D-M. In this, K is the N-terminal amino acid.

Add a comment
Know the answer?
Add Answer to:
(7 pts) What is the sequence of the following HEXAPEPTIDE? *PROVIDE WORK/ANSWER for B-F! (Use deductive...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • 2. (7 pts) What is the sequence of the following HEXAPEPTIDE? *PROVIDE WORK/ANSWER for B-F! (Use...

    2. (7 pts) What is the sequence of the following HEXAPEPTIDE? *PROVIDE WORK/ANSWER for B-F! (Use deductive reasoning) Observations from Sequencing Experiments: A. The Sequence contains the following amino acids: Y, R, M, K, G,D B. Reaction with 1-fluoro-2,4-dinitrobenzene yielded DNP-G. C. Treatment with chymotrypsin yielded two tripeptides. D. Treatment with trypsin yielded three dipeptides. E. Treatment with carboxypeptidase yielded methionine. F. N-terminal sequencing of one of the chymotrypsin-produced tripeptides yielded DNP-K Explanation and summary of protein sequencing techniques •...

  • Deduce the sequence of a heptapeptide that contains the amino acids Met, Gln, Phe, Leu, Cys,...

    Deduce the sequence of a heptapeptide that contains the amino acids Met, Gln, Phe, Leu, Cys, Val, and Arg, from the following experimental data. Edman degradation cleaves Cys from the heptapeptide, and carboxypeptidase forms Gln and a hexapeptide. Treatment of the heptapeptide with chymotrypsin forms a hexapeptide and a single amino acid. Treatment of the heptapeptide with trypsin forms a pentapeptide and a dipeptide. Partial hydrolysis forms Gln, Cys, Phe, and the tripeptides Leu-Met-Val and Met-Val-Arg. Be sure to answer...

  • 7. A peptide was isolated from sheep hypothalamus and subjected to sequence analysis. The experimental data...

    7. A peptide was isolated from sheep hypothalamus and subjected to sequence analysis. The experimental data are as follows. Deduce the amino acid sequence from this data. a. Composition (2Ala, 2Gly, Thr, Phe, Lys, His, Ser, Trp, Arg, Val) b. Reaction of dinitrofluorobenzene with the intact peptide yielded DNP-Thr. A brief treatment with carboxypeptidase a yielded glycine. c. Trypsin digestion yielded three fragments: i. Phe, Thr, Ala, Lys ii. Gly, Val iii. Trp, His, Ser, Gly, Arg, Ala Treatment of...

  • 1.  Partial hydrolysis of lysozyme yielded an octapeptide that was later identified as the N-terminal segment of...

    1.  Partial hydrolysis of lysozyme yielded an octapeptide that was later identified as the N-terminal segment of the protein.  From the following information, determine the sequence of this octapeptide. a.  The following amino acids were identified after complete hydrolysis of the octapeptide:             Arginine (Arg)                         Glycine (Gly)               Phenylalanine (Phe)             Cysteine (Cys)                        Leucine (Leu)              Valine (Val)             Glutamic Acid (Glu)                Lysine (Lys) b.  Treatment of the octapeptide with dinitroflurobenzene (Sanger reagent) followed by complete hydrolysis gave lysine (Lys) labeled with two dinitrophenyl (DNP) groups. c.  Treatment of the octapeptide with trypsin gave lysine...

  • Need help with #2 Clearly provide the 3-letter symbol for the correct sequence of cach amino...

    Need help with #2 Clearly provide the 3-letter symbol for the correct sequence of cach amino acid in each of listings of the amino acids in the peptide or in any fragments are simply listed in alphabetical order. A subscriptive the number of that amino acid. Use parentheses to incorporate the unknown amino acids after each treatment 1. A five amino acid peptide contains: Arg. Glu, His, Phe, and Ser This peptide yields the following results when broken down into...

  • biochemistry please show your work 2. A mutant form of polypeptide hormone angiotensin II has the...

    biochemistry please show your work 2. A mutant form of polypeptide hormone angiotensin II has the amino acid composition: Ile, Arg, Met, Leu, Phe, Asp, Tyr, and Val. The following observations are made: 1) Treatment with trypsin yields a dipeptide containing Asp and Arg, and a hexapeptide with all the rest. 2) Cyanogen bromide yields a dipeptide containing Phe and Leu and a hexapeptide containing all the rest. 3) Chymotrypsin cleaves the hormone into two tetrapeptides of composition: Val, Tyr,...

  • I need someone to help explain this to me please in great detail! Explain it to...

    I need someone to help explain this to me please in great detail! Explain it to me very simply. thank you! 31) A nonapeptide was determined to have the following amino acid composition: (Lys)2, (Gly)2, (Phe) 2, His, Leu, Met. The following are possible sequences for the peptide. A) G-F-K-K-G-L-M -F-H B) H-L-G-K-K-F-F-G-M C) H-L-F-G-K-K-F-M -G D) H-F-L-G-K-K-F-M-G E) M-L-F-K-F-G-G-K-H The following observations were made during sequence determination. (Hint: FDNB reacts with N-terminal amino groups and specificities of proteases listed...

  • A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...

    A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT
ADVERTISEMENT