Homework Answers
![NHh [senine ] [Tnypłophaw] ラTwo-Jypes of peptide bond is Possible OH Sen TEnp Peblide bond Coo Righ T3np -Se (b) Dipeplide -](http://img.homeworklib.com/questions/36836ad0-8f1c-11eb-8529-df61b331a73d.png?x-oss-process=image/resize,w_560)
Add Answer to:
s smı peptdes and ultimately proteins through a condensation fatt similar to the reactions that form...
The primary structure of a protein is formed by the condensation of amino acids in a...
The primary structure of a protein is formed by the condensation of amino acids in a certain sequence. Consider the dipeptide formed by the condensation of glycine and tyrosine in Figure 8.31B. a. Draw the structure of the dipeptide that would be formed if the two amino acids condensed in the opposite sequence. b. How are the structures of the dipeptides in Figure 8.31B and your drawing related to each other? B 0 HN-C-0--OH HO H-N-C-C-OH H CHE H OH...
1. Partial hydrolysis of lysozyme yielded an octapeptide that was later identified as the N-terminal segment of...
1. Partial hydrolysis of lysozyme yielded an octapeptide that was later identified as the N-terminal segment of the protein. From the following information, determine the sequence of this octapeptide. a. The following amino acids were identified after complete hydrolysis of the octapeptide: Arginine (Arg) Glycine (Gly) Phenylalanine (Phe) Cysteine (Cys) Leucine (Leu) Valine (Val) Glutamic Acid (Glu) Lysine (Lys) b. Treatment of the octapeptide with dinitroflurobenzene (Sanger reagent) followed by complete hydrolysis gave lysine (Lys) labeled with two dinitrophenyl (DNP) groups. c. Treatment of the octapeptide with trypsin gave lysine...
Question 10 (10 pts) Peptides are biological oligomers formed by condensing multiple amino acids into an...
Question 10 (10 pts) Peptides are biological oligomers formed by condensing multiple amino acids into an amide backbone. Although this amide backbone is common to all peptides, the so- called 'side-chan' groups attached to this backbone vary depending the amino acids used in the condensation reaction. Shown below are four different tetrapeptides (so-named because they are the products of the condensation of four amino acids). Based on their structures, predict the order of elution that one might expect if separating...
Question 1 (0.5 points) Saved Proteins are formed by joining together. carboxylic acids fatty acids amino...
Question 1 (0.5 points) Saved Proteins are formed by joining together. carboxylic acids fatty acids amino acids none of the above Question 2 (0.5 points) Which two functional groups does an amino acid contain? amine and carboxylic acid carboxylic acid and amide amide and heterocyclic ring heterocyclic ring and amine Question 3 (0.5 points) Do amino acids commonly exist in nature as neutral molecules with all uncharged atoms? Yes No Question 1 (0.5 points) What is a protein? A polymer...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
E. Review of Proteins and Enzymes wollenboom 10. Using the three-letter code provide all possible peptides...
E. Review of Proteins and Enzymes wollenboom 10. Using the three-letter code provide all possible peptides between Phe, Ala, Met and Cys; where Phe is at the N-terminus (not the structure). After this, answer the following questions: moto mons IDEN norto peptide (include the prefix, e.g. dipeptide). a) These amino acids will form a b) Indicate which amino acid(s) in the polypeptide can form a disulfide bond = c) Indicate which amino acid(s) in the polypeptide are polar neutral =...
1. What type of bond is formed between the amino acids of a protein? a. Peptide...
1. What type of bond is formed between the amino acids of a protein? a. Peptide b. Nucleopeptide c. Condensation d. Catalyst 2. A dipeptide has how many amino acids? 3. Which of the following is true about the functions of protein? A. proteins are required to metabolize fat B. proteins help buffer acids in the body C. proteins are the primary energy source for the body? D. all of the above 4. What is the recommended range of daily...
C. Review of Lipids 6. Draw the complete reaction for the hydrogenation and saponification of the...
C. Review of Lipids 6. Draw the complete reaction for the hydrogenation and saponification of the triacylglycerol below. Make sure you the reaction is balanced. HC I Hydrogenation reaction using 2 moles of H (9) banoro Saponification reaction os c) a cyclic secondary alcohol biolo wolvo Mode ostin obrolan insand word do Ya d) a tertiary amine that contains no more than 4 carbons. (0) Holmsgniew more nownegosby e) the aromatic isomers of an aromatic ring that contains one hydroxyl...
DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2...
DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2 Gene 1 Gene 3 DNA strand3 TRANSLATION Protein Trp Gly Model 2 ACTIVITY and QUESTIONS 1. Based on the information you can gather from model 1 complete the following sentences: a. The nucleotide Adenine (A) always pairs with the nucleotide b. The nucleotide Guanine (G) always pairs with the...
2. hypothesize the best conditions (pH and temperature) under which the enzyme chymotrypsin functions with an...
2. hypothesize the best conditions (pH and temperature) under
which the enzyme chymotrypsin functions with an appropriate
reference. also, hypothesize what will occur in the presence of an
inhibitor and the type of inhibition.
EXPERIMENT 5: ENZYME ACTIVITY WITH a-CHYMOTRYPSIN Prelab Assignment 1. Prepare a flow chart, covering one half of the experimental work (either part A and C if your lab bench is on the window side of the lab or part B and D if your locker is...
The primary structure of a protein is formed by the condensation of amino acids in a certain sequence. Consider the dipeptide formed by the condensation of glycine and tyrosine in Figure 8.31B. a. Draw the structure of the dipeptide that would be formed if the two amino acids condensed in the opposite sequence. b. How are the structures of the dipeptides in Figure 8.31B and your drawing related to each other? B 0 HN-C-0--OH HO H-N-C-C-OH H CHE H OH...
Question 10 (10 pts) Peptides are biological oligomers formed by condensing multiple amino acids into an amide backbone. Although this amide backbone is common to all peptides, the so- called 'side-chan' groups attached to this backbone vary depending the amino acids used in the condensation reaction. Shown below are four different tetrapeptides (so-named because they are the products of the condensation of four amino acids). Based on their structures, predict the order of elution that one might expect if separating...
Question 1 (0.5 points) Saved Proteins are formed by joining together. carboxylic acids fatty acids amino acids none of the above Question 2 (0.5 points) Which two functional groups does an amino acid contain? amine and carboxylic acid carboxylic acid and amide amide and heterocyclic ring heterocyclic ring and amine Question 3 (0.5 points) Do amino acids commonly exist in nature as neutral molecules with all uncharged atoms? Yes No Question 1 (0.5 points) What is a protein? A polymer...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
E. Review of Proteins and Enzymes wollenboom 10. Using the three-letter code provide all possible peptides between Phe, Ala, Met and Cys; where Phe is at the N-terminus (not the structure). After this, answer the following questions: moto mons IDEN norto peptide (include the prefix, e.g. dipeptide). a) These amino acids will form a b) Indicate which amino acid(s) in the polypeptide can form a disulfide bond = c) Indicate which amino acid(s) in the polypeptide are polar neutral =...
C. Review of Lipids 6. Draw the complete reaction for the hydrogenation and saponification of the triacylglycerol below. Make sure you the reaction is balanced. HC I Hydrogenation reaction using 2 moles of H (9) banoro Saponification reaction os c) a cyclic secondary alcohol biolo wolvo Mode ostin obrolan insand word do Ya d) a tertiary amine that contains no more than 4 carbons. (0) Holmsgniew more nownegosby e) the aromatic isomers of an aromatic ring that contains one hydroxyl...
DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2 Gene 1 Gene 3 DNA strand3 TRANSLATION Protein Trp Gly Model 2 ACTIVITY and QUESTIONS 1. Based on the information you can gather from model 1 complete the following sentences: a. The nucleotide Adenine (A) always pairs with the nucleotide b. The nucleotide Guanine (G) always pairs with the...
2. hypothesize the best conditions (pH and temperature) under
which the enzyme chymotrypsin functions with an appropriate
reference. also, hypothesize what will occur in the presence of an
inhibitor and the type of inhibition.
EXPERIMENT 5: ENZYME ACTIVITY WITH a-CHYMOTRYPSIN Prelab Assignment 1. Prepare a flow chart, covering one half of the experimental work (either part A and C if your lab bench is on the window side of the lab or part B and D if your locker is...
Most questions answered within 3 hours.
-
5. Draw Molecular Orbital Diagrams for C2, C2 and C2. a. Determine the bond order for...
asked 3 years ago -
The emergency room at Hospital Systems, Inc (HIS) serves
patients who arrive according to
a Poisson...
asked 10 minutes ago -
The chickens at Colonel Thompson's Ranch have a mean weight of
1850 g, with a standard...
asked 23 minutes ago -
The time married men with children spend on child care averages
5.9 hours per week (Time,...
asked 28 minutes ago -
There are many minerals which contain sliver. One of them,
smithite, is placed in water and...
asked 26 minutes ago -
22.3 g of fructose, C6H12O6,
are dissolved completely in 75.5 mL of pure water at 20.0...
asked 49 minutes ago -
Two bankrobbers are standing side by side, trying to push open
the door of a safe...
asked 50 minutes ago -
2. You want to buy a house. You can make an initial payment of
$200,000 and...
asked 47 minutes ago -
Why study the ‘Economic environment’ of a country? Describe the
information you will be collecting in...
asked 38 minutes ago -
A chandelier with mass m is suspended from a cable with mass M
from the ceiling....
asked 47 minutes ago -
How many disk accesses are needed to bring byte i of a file
into memory when...
asked 51 minutes ago -
Compare/Contrast the Lac and Ara operons.
asked 1 hour ago