a) Which of the two following
peptides is most likely to form an amphipathic α-helix? Explain
your choice. Peptide #1: SANKSEQLKA or Peptide #2: SLANEAQKLR (b)
Which of the two following peptides is most likely to be a β-strand
in an amphipathic β-sheet? Explain your choice. Peptide #3:
KASNELQLKA or Peptide #4: ELSKNLKAQL
Homework Answers
Add Answer to:
a) Which of the two following
peptides is most likely to form an amphipathic α-helix? Explain...
Question 4: Which of the following sequences will most likely form an α-helix. a) GGGAGGGAGGGAGGGA b)...
Question 4: Which of the following sequences will most likely form an α-helix. a) GGGAGGGAGGGAGGGA b) NICETRY c) AMINEACIDSALHAHELICES d) MAD e) AGGGAGGGAGGGAGGGA
11.Which of the following mutations would most likely to disrupt the structure of an α-helix? Cys...
11.Which of the following mutations would most likely to disrupt the structure of an α-helix? Cys to Ala Lys to Arg Glu to Gly Val to Leu 12.Which amino acid combination is the most preferred to occupy positions 1 and 4 in an α-helix? Glu and Lys Phe and Pro Lys and Arg Asp and Glu 13.If each turn in the standard alpha helix extends 5.4 A and there are 3.6 amino acid residues per turn, how many amino acids...
25. Consider two peptide sequences: LKAENDEAARAMSEA and CRAGGFPWDQPGTSN. Which of the two is more likely to adopt an al...
25. Consider two peptide sequences: LKAENDEAARAMSEA and CRAGGFPWDQPGTSN. Which of the two is more likely to adopt an alpha-helical structure? Why? 26. A beta strand is a stretch of residues in the extended conformation that can participate in a beta sheet. (In the figure at right, beta strands A and B participate in a two-strand sheet.) What sorts of hydrogen bonds are required for the formation of single beta strands and for the formation of beta sheets? backbone- backbone sidechain...
25. Consider two peptide sequences: LKAENDEAARAMSEA and CRAGGFPWDQPGTSN. Which of the two is more likely to adopt an al...
25. Consider two peptide sequences: LKAENDEAARAMSEA and CRAGGFPWDQPGTSN. Which of the two is more likely to adopt an alpha-helical structure? Why? 26. A beta strand is a stretch of residues in the extended conformation that can participate in a beta sheet. (In the figure at right, beta strands A and B participate in a two-strand sheet.) What sorts of hydrogen bonds are required for the formation of single beta strands and for the formation of beta sheets? backbone- backbone sidechain...
(2%) Indicate which secondary structure or structures (α -helix, β -pleated, random coil) will the following...
(2%) Indicate which secondary structure or structures (α -helix,
β -pleated, random coil) will the following peptide adopt in an
aqueous solution at pH 7
(2%) The unfolding of the alpha helix of a polypeptide to a
randomly coiled conformation is accompanied by a large decrease in
a property called specific rotation, a measure of
a solution’s capacity to rotate circularly polarized light.
Polyglutamate, a polypeptide made up of only L-Glu residues, has
the alpha helical
conformation at pH 3....
Based on the chemical properties of the residues, which of the following sequences could form the...
Based on the chemical properties of the residues, which of the
following sequences could form the following? At least one should
be placed in each category.
Based on the chemical properties of the residues, which of the following sequences could form the following? At least one should be placed in each category Most likely an amphipathic Most likely an amphipathic B sheet a helix Most likely a turn/ loop Not amphipathic Asn-Leu-Ala-Asp-Ser-Phe-Arg-Gin-lle Lys-Ser-Thr-Asn-Glu-Gin-Asn-Ser-Arg Gin-lle-Thr-Phe-Thr-Leu-GIn-Val-Ser Lys-GIn-Asn-Glu-Pro-Arg-Ala-Asn-Glu Arg-Phe-GIn-lle-His-Val-Gin-Phe-Glu Ala-Phe-Leu-Val-lle-Trp-Phe-Val-Ala
Explain why α-helices are most commonly observed in transmembrane protein sequences when the distance from one...
Explain why α-helices are most commonly observed in
transmembrane protein sequences when the distance from one side of
a membrane to the other can be spanned by significantly fewer amino
acids in a β-strand conformation.
Match the items in the left column to the appropriate blanks in
the sentences on the right.
prevents within a The structure of an a-helix promotes stretch of amino acids, and at the same time contiguous interactions with other important molecules involved in in the...
Explain why α-helices are most commonly observed in transmembrane protein sequences when the distance from one...
Explain why α-helices are most commonly observed in
transmembrane protein sequences when the distance from one side of
a membrane to the other can be spanned by significantly fewer amino
acids in a β-strand conformation.
Match the items in the left column to the appropriate blanks in
the sentences on the right.
noncontiguous The structure of an a-helix promotes within a stretch of amino acids, contiguous and at the same time interactions with other important molecules involved in in the...
17 Which of the following statements is not TRUE with respect to the structure of DNA?...
17 Which of the following statements is not TRUE with respect to the structure of DNA? uswered of 2.50 uestion Select one: a. All options are true with respect to the structure of DNA b. The backbone of DNA is formed by phosphodiester links that binds the 5' end of one nucleotide to the 3' of the next one. c. The two strands that form DNA are complementary and antiparallel to each other d. The alpha helix is the consequence...
Which of the following peptides will migrate the farthest in SDS-PAGE? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2:...
Which of the following peptides will migrate the farthest in SDS-PAGE? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2: AWSDEGYIMN Peptide 3: MKLLVTYYICDEEPAQR Peptide 4: FVCCNTTRLEWWQNMSCKLAAPICNMRTTY Which of the following peptides will migrate the farthest in SDS-PAGE? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2: AWSDEGYIMN Peptide 3: MKLLVTYYICDEEPAQR Peptide 4: FVCCNTTRLEWWQNMSCKLAAPICNMRTTY Peptide 1 Peptide 2 Peptide 3 Peptide 4
25. Consider two peptide sequences: LKAENDEAARAMSEA and CRAGGFPWDQPGTSN. Which of the two is more likely to adopt an alpha-helical structure? Why? 26. A beta strand is a stretch of residues in the extended conformation that can participate in a beta sheet. (In the figure at right, beta strands A and B participate in a two-strand sheet.) What sorts of hydrogen bonds are required for the formation of single beta strands and for the formation of beta sheets? backbone- backbone sidechain...
25. Consider two peptide sequences: LKAENDEAARAMSEA and CRAGGFPWDQPGTSN. Which of the two is more likely to adopt an alpha-helical structure? Why? 26. A beta strand is a stretch of residues in the extended conformation that can participate in a beta sheet. (In the figure at right, beta strands A and B participate in a two-strand sheet.) What sorts of hydrogen bonds are required for the formation of single beta strands and for the formation of beta sheets? backbone- backbone sidechain...
(2%) Indicate which secondary structure or structures (α -helix,
β -pleated, random coil) will the following peptide adopt in an
aqueous solution at pH 7
(2%) The unfolding of the alpha helix of a polypeptide to a
randomly coiled conformation is accompanied by a large decrease in
a property called specific rotation, a measure of
a solution’s capacity to rotate circularly polarized light.
Polyglutamate, a polypeptide made up of only L-Glu residues, has
the alpha helical
conformation at pH 3....
Based on the chemical properties of the residues, which of the
following sequences could form the following? At least one should
be placed in each category.
Based on the chemical properties of the residues, which of the following sequences could form the following? At least one should be placed in each category Most likely an amphipathic Most likely an amphipathic B sheet a helix Most likely a turn/ loop Not amphipathic Asn-Leu-Ala-Asp-Ser-Phe-Arg-Gin-lle Lys-Ser-Thr-Asn-Glu-Gin-Asn-Ser-Arg Gin-lle-Thr-Phe-Thr-Leu-GIn-Val-Ser Lys-GIn-Asn-Glu-Pro-Arg-Ala-Asn-Glu Arg-Phe-GIn-lle-His-Val-Gin-Phe-Glu Ala-Phe-Leu-Val-lle-Trp-Phe-Val-Ala
Explain why α-helices are most commonly observed in
transmembrane protein sequences when the distance from one side of
a membrane to the other can be spanned by significantly fewer amino
acids in a β-strand conformation.
Match the items in the left column to the appropriate blanks in
the sentences on the right.
prevents within a The structure of an a-helix promotes stretch of amino acids, and at the same time contiguous interactions with other important molecules involved in in the...
Explain why α-helices are most commonly observed in
transmembrane protein sequences when the distance from one side of
a membrane to the other can be spanned by significantly fewer amino
acids in a β-strand conformation.
Match the items in the left column to the appropriate blanks in
the sentences on the right.
noncontiguous The structure of an a-helix promotes within a stretch of amino acids, contiguous and at the same time interactions with other important molecules involved in in the...
17 Which of the following statements is not TRUE with respect to the structure of DNA? uswered of 2.50 uestion Select one: a. All options are true with respect to the structure of DNA b. The backbone of DNA is formed by phosphodiester links that binds the 5' end of one nucleotide to the 3' of the next one. c. The two strands that form DNA are complementary and antiparallel to each other d. The alpha helix is the consequence...
Most questions answered within 3 hours.
-
Suppose N packets are sent,
and each packet arrives at rate of L/2R to a link....
asked 6 minutes ago -
17. Show the steps involved in reduction of the ketone in fatty
acid synthesis. Which cofactor...
asked 8 minutes ago -
5.61 g of octane, C8H18, reacts with excess oxygen in a bomb
calorimeter. The heat capacity...
asked 12 minutes ago -
The velocity field of a flow is given by V = (2+1) x
y2 i +...
asked 21 minutes ago -
(EPS with
Convertible Bonds) On June 1, 2012, Bluhm Company and
Amanar Company merged to form...
asked 18 minutes ago -
2. Discuss why the study exemplifies one that agrees with The
American Psychological Association’s (APA) Ethical...
asked 22 minutes ago -
Without considering the following capital gains and losses,
Charlene, who is single, has a taxable income...
asked 30 minutes ago -
1a. The __________ functional group often triggers our sense of
smell.
1b. The geometry around a...
asked 43 minutes ago -
A uniform plank of length 2.00 m and mass 34.0 kg is supported
by three ropes,...
asked 44 minutes ago -
Suppose a floor on a hospital has 12 physicians at any given
time. You are brought...
asked 58 minutes ago -
Compartmentalization
in eukaryotic cells facilitates chemical reactions happening faster
due to... Select all
Substrates needed for...
asked 44 minutes ago -
The deltaH for the solution process when solid sodium
hydroxide dissolves in water is 44.4 kJ/mol....
asked 47 minutes ago