Homework Answers
Add Answer to:
11/. Explain how this synthesis of amino acids, starting with natural proline, works. Explain the stereoselectivity...
10 and 11 10/ in the following two-steps thermally initiated transformation, what is the structure of...
10 and 11
10/ in the following two-steps thermally initiated transformation, what is the structure of the intermediate that is formed? c., có con 11/. Explain how this synthesis of amino acids, starting with natural proline, works. Explain the stereoselectivity of each step after the first. HOR - н A NH HẠO HR COH * HOC NH2 HLR
please explain your answers 11. Indicate whether the pairs of compounds shown below are enantiomers, diastereomers,...
please explain your answers
11. Indicate whether the pairs of compounds shown below are enantiomers, diastereomers, structural (constitutional) isomers, the same compound, or different compounds which are not isomers. (0.25 pts ea = 1 pt) vs. нон Но н. он он HOCHS HT CH3 C vs. Broh H₃CH НОСН2СНО нон нон H How HOCH CHO н JONH2 NH2 HOC CH2SH HSCHE CO2H
how to draw a phylogeny tree based on the information of amino acids in table 2...
how to draw a phylogeny tree
based on the information of amino acids in table 2 ?with
explanation please
by using the amino acid differences between the species in the
table, for example it can be seen that chimpanzees are similar to
humans .....
. S . FEE Table 2 Mitochondrial cytochrome oxidase subunit II (CO II) amino acids (aa) 1-30 of the 227 total aa for the primate species Lemur catta, Paio ursinus, Pan troglodytes, Hylobates lar, Homo sapiens,...
how do you solve for these? HOW DO YOU SOLVE THESE QUESTIONS STEP BY STEP MECHANISMS...
how do you solve for these?
HOW
DO YOU SOLVE THESE QUESTIONS STEP BY STEP MECHANISMS
3. Show a mechanism for the following (Grant Challenge). Hint at end with * if you need it. - this is for the people that want a big challenge and who are already very comfortable with mechanisms. 3. Na2CO3, H, 0 0 4. Propose a synthesis for the following, starting from methanolas your only carbon-based starting material. ool logo Me 5. Classify the following...
The scheme below shows the synthesis of an antihypertensitive agent (drug used to treat high blood...
The scheme below shows the synthesis of an antihypertensitive agent (drug used to treat high blood pressure). Answer the questions that follows. a Br 1 Br CI с CO Me + Meo H2NCO Me (Question 3) B OME CN CN CN CN 6 2 3 4 5 CO Me CO Me Buz SnNz d Final product (9) (1) KOH, heat (2) H+ work up partial hydrolysis (Question 4) CAH, CAH, CN 7 NH NEN 8 Question 1 Select the best...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
Synthesis using Carbonyla-Substitution Chemistry Preamble This experiment involves the synthesis of target molecules using a-substitution chemistry....
Synthesis using Carbonyla-Substitution Chemistry Preamble This experiment involves the synthesis of target molecules using a-substitution chemistry. You are assigned two target molecules, one of which is best synthesized by an alkylation approach, while the other is best synthesized by an addition or condensation approach. My two target molecules are number 2 and number 12 in the last page. You must do the following: 1. Perform a retrosynthetic analysis on the two target molecules assigned to you. In each case the...
Page 1 Synthesis using Carbonyl O-Substitution Chemistry Preamble This experiment involves the synthesis of target molecules...
Page 1 Synthesis using Carbonyl O-Substitution Chemistry Preamble This experiment involves the synthesis of target molecules using a-substitution chemistry. You are assigned two target molecules, one of which is best synthesized by an alkylation approach, while the other is best synthesized by an addition or condensation approach. You must do the following: 1. Perform a retrosynthetic analysis on the two target molecules assigned to you. In each case the organic starting material (what you have to work backwards toward) depends...
11 Department of Biological Sciences BIOCHEMISTRY Test 2.2018 H. Nucleic Acid, Sequencing of DNA: Amino Acids...
11 Department of Biological Sciences BIOCHEMISTRY Test 2.2018 H. Nucleic Acid, Sequencing of DNA: Amino Acids Hydrolysis of salt Laboratory buffers, Polyprotie acids QUESTIONS 1. The DNA strand complementary to the strand 3-GTAGCGTAT-Y' would have the sequence a SLTACOCATAT-3 b.3.CATOXICATA-S c. 3-ATGCGTATA-S" ATATGCGTAS 2. When cytosine is treated with bisulfite, the amino group is replaced with a carbonyl group. Identify the resulting base a. adenine b. guanine c uracil d. thyminee. typoxanthine 3. How many amino acids would be in...
**(left structure)****(right structure)** The two structures for the assignment are above and the task is: 1....
**(left structure)****(right
structure)**
The two structures for the assignment are above and
the task is:
1. Perform a retrosynthetic analysis on the two target
molecules assigned to you. In each case the organic
starting material (what you have to work backwards toward) depends
upon the target. For the structure given above (structure on left),
the starting material is either malonic ester or acetoacetic ester
and any halide. For the structure given above (structure on right),
the starting material is any...
10 and 11
10/ in the following two-steps thermally initiated transformation, what is the structure of the intermediate that is formed? c., có con 11/. Explain how this synthesis of amino acids, starting with natural proline, works. Explain the stereoselectivity of each step after the first. HOR - н A NH HẠO HR COH * HOC NH2 HLR
please explain your answers
11. Indicate whether the pairs of compounds shown below are enantiomers, diastereomers, structural (constitutional) isomers, the same compound, or different compounds which are not isomers. (0.25 pts ea = 1 pt) vs. нон Но н. он он HOCHS HT CH3 C vs. Broh H₃CH НОСН2СНО нон нон H How HOCH CHO н JONH2 NH2 HOC CH2SH HSCHE CO2H
how to draw a phylogeny tree
based on the information of amino acids in table 2 ?with
explanation please
by using the amino acid differences between the species in the
table, for example it can be seen that chimpanzees are similar to
humans .....
. S . FEE Table 2 Mitochondrial cytochrome oxidase subunit II (CO II) amino acids (aa) 1-30 of the 227 total aa for the primate species Lemur catta, Paio ursinus, Pan troglodytes, Hylobates lar, Homo sapiens,...
how do you solve for these?
HOW
DO YOU SOLVE THESE QUESTIONS STEP BY STEP MECHANISMS
3. Show a mechanism for the following (Grant Challenge). Hint at end with * if you need it. - this is for the people that want a big challenge and who are already very comfortable with mechanisms. 3. Na2CO3, H, 0 0 4. Propose a synthesis for the following, starting from methanolas your only carbon-based starting material. ool logo Me 5. Classify the following...
The scheme below shows the synthesis of an antihypertensitive agent (drug used to treat high blood pressure). Answer the questions that follows. a Br 1 Br CI с CO Me + Meo H2NCO Me (Question 3) B OME CN CN CN CN 6 2 3 4 5 CO Me CO Me Buz SnNz d Final product (9) (1) KOH, heat (2) H+ work up partial hydrolysis (Question 4) CAH, CAH, CN 7 NH NEN 8 Question 1 Select the best...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
Synthesis using Carbonyla-Substitution Chemistry Preamble This experiment involves the synthesis of target molecules using a-substitution chemistry. You are assigned two target molecules, one of which is best synthesized by an alkylation approach, while the other is best synthesized by an addition or condensation approach. My two target molecules are number 2 and number 12 in the last page. You must do the following: 1. Perform a retrosynthetic analysis on the two target molecules assigned to you. In each case the...
Page 1 Synthesis using Carbonyl O-Substitution Chemistry Preamble This experiment involves the synthesis of target molecules using a-substitution chemistry. You are assigned two target molecules, one of which is best synthesized by an alkylation approach, while the other is best synthesized by an addition or condensation approach. You must do the following: 1. Perform a retrosynthetic analysis on the two target molecules assigned to you. In each case the organic starting material (what you have to work backwards toward) depends...
11 Department of Biological Sciences BIOCHEMISTRY Test 2.2018 H. Nucleic Acid, Sequencing of DNA: Amino Acids Hydrolysis of salt Laboratory buffers, Polyprotie acids QUESTIONS 1. The DNA strand complementary to the strand 3-GTAGCGTAT-Y' would have the sequence a SLTACOCATAT-3 b.3.CATOXICATA-S c. 3-ATGCGTATA-S" ATATGCGTAS 2. When cytosine is treated with bisulfite, the amino group is replaced with a carbonyl group. Identify the resulting base a. adenine b. guanine c uracil d. thyminee. typoxanthine 3. How many amino acids would be in...
**(left structure)****(right
structure)**
The two structures for the assignment are above and
the task is:
1. Perform a retrosynthetic analysis on the two target
molecules assigned to you. In each case the organic
starting material (what you have to work backwards toward) depends
upon the target. For the structure given above (structure on left),
the starting material is either malonic ester or acetoacetic ester
and any halide. For the structure given above (structure on right),
the starting material is any...
Most questions answered within 3 hours.
-
A college student is employed as a door-to-door newspaper
salesman. Historical data suggests that the student...
asked 11 minutes ago -
Considering gravitational time dilation, calculate the time that
passes in Earth’s surface while 1 hour passes...
asked 35 minutes ago -
Minitab Problem: Take the Lake Hume June rainfall data and find
use the processes outlined in...
asked 1 hour ago -
X Company is trying to decide whether to continue using old
equipment to make Product A...
asked 1 hour ago -
IN PYTHON ONLY !! Program 2: Re-work
program #5 (WeeklyHours) from the previous assignment such that...
asked 2 hours ago -
The average length of time between arrivals at a turnpike
toll-booth is 26 seconds. What is...
asked 3 hours ago -
(a) A piston at 6.1 atm contains a gas that occupies a volume of
3.5 L....
asked 4 hours ago -
Please answer true or false. Words
cannot be changed or added in to make it true...
asked 4 hours ago -
An empty test tube weighs 15.923 grams. Then,
MgCl2•6H2O is added into the test tube. After...
asked 4 hours ago -
Assume memory access is 10 units of time and disk access is
10000 units of time....
asked 5 hours ago -
1. Are all good samples random?
2. Magazines often report surveys giving statistics such as “63%...
asked 5 hours ago -
Under all the various types of market structures, firms
must eventually earn some economic profits for...
asked 5 hours ago