Question

Hf.vol E.coli N.gono B.sub M.tub 1 MTTTPNOGTSHAPIFDLVTD VFGTGRHKPNRTGVDTISGFSKHYTVDLQEGFPLLTTKDL 1 ..........MKOYLELMOK VLDEG

What is the main difference between protein sequence of thymidylate synthase from H. volcanii and other organisms according to the photo provided?

0 0
Add a comment Improve this question Transcribed image text
Answer #1

There are two additional domains, one of around 18 amino acids and other of around 51 amino acids in H. volcanii. At the start of the protein sequence there are 8 amino acids in H.volcanii which are absent in others.

Add a comment
Know the answer?
Add Answer to:
What is the main difference between protein sequence of thymidylate synthase from H. volcanii and other...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • Maintaining a healthy weight is important for women’s health. Some physicians recommend being back to your...

    Maintaining a healthy weight is important for women’s health. Some physicians recommend being back to your pre-pregnancy weight six months after giving birth. Public health officials are interested in whether this is a realistic goal. Do the women in North Carolina weigh more than their pre-pregnancy weight six months postpartum? In other words, is the six months post-pregnancy weight greater than their pre-pregnancy weight? Use a paired samples t-test to compare pst6wght (variable 1) and prewght (variable 2). This uses...

  • On May 3, 2020, Leven Corp. negotiated a short-term loan of $780,000. The loan is due...

    On May 3, 2020, Leven Corp. negotiated a short-term loan of $780,000. The loan is due October 1, 2020, and carries a 6.20% interest rate. Use ordinary interest to calculate the interest. What is the total amount Leven would pay on the maturity date? (Use Days in a year table.) (Do not round intermediate calculations. Round your answer to the nearest cent.) TABLE 7-1 Exact days-in-a-year calendar (excluding leap year) 31 Day of month Dec. 31 Jan 1 2 3...

  • On May 3, 2020, Leven Corp. negotiated a short-term loan of $900,000. The loan is due...

    On May 3, 2020, Leven Corp. negotiated a short-term loan of $900,000. The loan is due October 1, 2020, and carries a 7.00% interest rate. Use ordinary interest to calculate the interest. What is the total amount Leven would pay on the maturity date? (Use Days in a year table.) (Do not round intermediate calculations. Round your answer to the nearest cent.) TABLE 7-1 Exact days-in-a-year calendar (excluding leap year) 31 Day of month Dec. 31 Jan 1 2 3...

  • 33 On May 6, Jim Ryan borrowed $14,000 from Lane Bank at 7 % interest. Jim...

    33 On May 6, Jim Ryan borrowed $14,000 from Lane Bank at 7 % interest. Jim plans to repay the loan on March 11. Assume the loan is on ordinary interest. How much will Jim repay on March 11? (Use Days in a year table) (Round your answer to the nearest cent.) Jm repay etbook 7-1 TABLE Exact days-in-a-year calendar (excluding leap year)" Day of month 30 31 30 31 28 31 30 31 31 30 31 31 Dec Mar...

  • Zion, Inc. has one employee who has worked January - June of the current year. The...

    Zion, Inc. has one employee who has worked January - June of the current year. The employee is single, paid weekly, and claims three allowances on her W-2. The company is in a state that has no state income taxes. The FICA Social Security tax rate is 6.2 % on the first $118,500 of wages and the FICA Medicare tax rate is 1.45% on all wages. Zion, Inc.'s FUTA tax rate is 0.6 % on the first $7,000 of wages...

  • Zippy, LLC has one employee who has worked January - June of the current year. The...

    Zippy, LLC has one employee who has worked January - June of the current year. The employee is single, paid weekly, and claims three allowances on her W-2. The company is in a state that has no state income taxes. The FICA Social Security tax rate is 6.2% on the first $118.500 of wages and the FICA Medicare tax rate is 1.45% on all wages. Zippy, LLCS FUTA tax rate is 0.6% on the first $7,000 of wages and their...

  • Bubba's Burgers - Statistics Question

    Sampled StoreDessert Orders Per 1,000 TransactionsStore 1185Store 2226Store 3290Store 4226Store 5255Store 6293Store 7138Store 8203Store 9276Store 10173Store 11275Store 12199Store 13213Store 14321Store 1597Store 16152Store 17319Store 18193Store 19126Store 20215Store 21186Store 22289Store 23181Store 24196Store 25183Store 2690Store 27178Store 28103Store 29173Store 30231Store 31158Store 32202Store 33234Store 34273Store 35218Store 36247Store 37223Store 38108Store 39238Store 40143Store 41206Store 42300Store 4389Store 44202Store 45250Store 46210Store 47137Store 48215Store 49204Store 50188Store 51255Store 52196Store 53123Store 54189Store 55206Store 56146Store 57136Store 58211Store 59164Store 60246Store 61324Store 62125Store 63195Store 64173Store 65179Store 6676Store 67248Store 68199Store 69223Store 70240Store 71224Store 72215Store 73222Store 74170Store...

  • 40kN Uniform Load W kN/m X Span L L/2 Figure 1 SPAN L 6 W 11Kn/m Beam is 200 UB 18.2 Use the diagram above and the W an...

    40kN Uniform Load W kN/m X Span L L/2 Figure 1 SPAN L 6 W 11Kn/m Beam is 200 UB 18.2 Use the diagram above and the W and L values assigned to you to: a) Use your shear force diagram to calculate the Maximum longitudinal Shear Stress and where it occ Ccurs. b) Calculate the longitudinal Shear Stress at d/4 from the neutral axis. Check Figures 283 below this table BENDING MOMENT DIAGLAM Kp/m f:40 zm 7.5 KN-M 90...

  • Row and Flow is a sports brand that specializes in rowing gear and apparel. They are...

    Row and Flow is a sports brand that specializes in rowing gear and apparel. They are currently selling two boats: The King is a high end boat, very high quality and also quite expensive. This boat is a slow moving item, and its monthly demand is estimated to follow a poisson distribution with a lambda of 1. Speedy is a medium quality, more affordable boat. In any given month, the total number of orders for Speedys is uniformly distributed between...

  • QUESTION 7 The data set Beer Large, which can be found in StatCrunch Shared Data Sets,...

    QUESTION 7 The data set Beer Large, which can be found in StatCrunch Shared Data Sets, gives the Alcohol, Carbohydrates and Calories for different brands of beer. The explanatory variable is x + Carbohydrates and the response variable is Y - Calories. Use this information to answer: Calculate the correlation between carbohydrates and calories. (4 decimal places) Row vars varo var var 8 var9 var 10 2 الميا ABV 4.1 5.4 4.43 4.13 5.9 4.9 Carbs 2.6 13.7 5.8 5...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT
ADVERTISEMENT