Question

Question 2: Transcription, RNA Processing and Translation A particular gene codes for a mature mRNA transcript...

Question 2: Transcription, RNA Processing and Translation A particular gene codes for a mature mRNA transcript containing 1200 bases, which is translated into a protein containing 300 amino acids.

A. How long is the coding sequence in this mRNA and how many nucleotides are in the UTRs? For the purposes of this question we are ignoring the G’ cap and the polyA tail.

B. A mutant form of the gene created by one nucleotide being changed to another nucleotide also yields a 1200-base mature mRNA transcript but the protein made from the mutant gene only contains 280 amino acids and has somewhat modified enzymatic activity.

(i) What type of mutation most likely happened in this mutant?

(ii) Why might the activity of the protein be only “somewhat modified”? Explain.

C. Another mutant form of the gene yields a 1500-base mature mRNA transcript (so longer than it was before) and the protein made from the mutant gene contains 150 amino acids and has no enzymatic activity.

(i) Describe the mutation (and its outcome) that may have occurred that would lead to a longer mature mRNA transcript and a modified coding region.

(ii) Why might the activity of this protein be a complete loss of function? Explain.

0 0
Add a comment Improve this question Transcribed image text
Answer #1

A. It has 903 bases coding sequence and 297 bases UTR region.

B. I) point mutation in codon probably has changed it into stop codon earlier than actual termination sequence. For example transversion of C into G in UAC(tryptophan codon) to UAG(stop codon) will have same results.

II). As it has 280 AA and will be lacking the terminal 20 AA, active site may still be there in 280 AA globulin so it might happen that enzyme still work.

C. I). Increase in transcript length by 300 bases may have happened because of mutations at splicing site and therefore intron retention by the transcript. As this retained intron is coding for additional 150 amino acids, it is not in UTR region and be somewhere inside the coding region.

II). As this extra 150 AA chain will be somewhere inside the peptide chain(not at terminal), it will possibly change the entire conformation of peptide residues and organisations leading to complete loss of function.

Add a comment
Know the answer?
Add Answer to:
Question 2: Transcription, RNA Processing and Translation A particular gene codes for a mature mRNA transcript...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • You perform an experiment in which you add a synthetic mRNA to a test tube that...

    You perform an experiment in which you add a synthetic mRNA to a test tube that contains all components required for translation (it was just lacking the mRNA). You find that a polypeptide consisting of 122 amino acids is produced. Then you perform another experiment, this time adding the mRNA from a mutant version of the gene and find that a polypeptide consisting of 48 amino acids was produced. What is a likely explanation for this observation? A. The mutant...

  • QUESTION 1 RNA poll initiates synthesis of the mRNA transcript without a primer True O False...

    QUESTION 1 RNA poll initiates synthesis of the mRNA transcript without a primer True O False QUESTION 2 En The +1 position identifies the location for translation to begin when bound the mRNA is bound by the ribosomal subunit. True False QUESTION 3 The small ribosomal subunit binds the mRNA transcript at a sequence that is complementary to the gene promoter in order to initiate translation. O True False QUESTION 4 The 5' cap is necessary for protection from exonuclease...

  • 3. (1.8 points) The normal CFTR gene contains these six codons near the middle of the...

    3. (1.8 points) The normal CFTR gene contains these six codons near the middle of the transcript: AUU UCU VUA GCA AGA GCU... Al The corresponding amino acids in the normal CFTR protein are: (Use either the one-or three-letter amino acid codes A naint mutation changes the last nucleotide from U to C. At the DNA level, this is a transition transversion c) At the protein level, this is a (silent / missense / nonsense/frameshift ) mutation. D) Instead of...

  • pls fo all 20) A) an enzyme that synthesizes RNA as part of the transcription process...

    pls fo all 20) A) an enzyme that synthesizes RNA as part of the transcription process B) an enzyme that uses RNA as a substrate C) an enzyme that catalyzes the association between the large and small ribosomal subunits D) an enzyme that synthesizes RNA primers during DNA replication E) an RNA with enzymatic activity 20) What is a ribozyme? 21) 21) Alternative RN A splicing A) increases the rate of transcription. B) can allow the production of similar proteins...

  • 2. When transcribing an mRNA strand, RNA polymerase uses the strand of DNA to match complementary...

    2. When transcribing an mRNA strand, RNA polymerase uses the strand of DNA to match complementary bases with. RNA polymerase always reads this strand in the direction and always builds mRNA in the direction. (1.5 pts) 3. (0.5 pt) What is the significance of the +1 site in regards to transcription of mRNA? t) When translating an mRNA sequence, where does the ribosome always begin? 5. (0.5 pt) When translating an mRNA sequence, what signals the ribosome to end translation?...

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

  • Please answer all.... Thank you! 81)If a polypeptide chain contains 600 amino acids, then the gene...

    Please answer all.... Thank you! 81)If a polypeptide chain contains 600 amino acids, then the gene coding for this polypeptide must contain _____. 600 nucleotides 1200 nucleotides 1800 nucleotides 1800 codons 1800 anticodons More than one of the above are correct. 82) When we altered gene triplet in the DNA produces a chain-terminating codon in the mRNA, the (1pts) result is called a reverse mutation nonsense mutation missense mutation spontaneous mutation frameshift mutation 83) A single base substitution changes the...

  • 13. Why are ribonucleoside triphosphates the monomers required for RNA synthesis rather than ribonucleoside monophosphates? A....

    13. Why are ribonucleoside triphosphates the monomers required for RNA synthesis rather than ribonucleoside monophosphates? A. Only ribonucleoside triphosphates contain the sugar ribose. B. Ribonucleoside triphosphates have low potential energy, making the polymerization reaction endergonic. C. Ribonucleoside triphosphates have high potential energy, making the polymerization reaction exergonic. D. Ribonucleoside monophosphates cannot form complementary base pairs with the DNA template. E. Ribonucleoside triphosphates are not used, rather all use deoxyriboside triphosphates. 14. How is a mutation in a bacterial cell that...

  • DNA DNA Replication: ONA Because DNA Is the ge m Tumes and heart e ine in...

    DNA DNA Replication: ONA Because DNA Is the ge m Tumes and heart e ine in process called DNA curs in the nucleus of s acest FS Parent strand Parent strand Newly replicated DNA Newly replicated DNA- SA0 Daughter DNA molecule Daughter DNA molecule Figure 8.2: Overview of DNA replication and illustration of complementary base pairing. DNA must replicate before cell division so that each new daughter cell receives an exact copy of the parent DNA. 1. Replication begins when...

  • QUESTION 6 Assume you are studying a protein-coding gene, ACEX, which includes 4 exons as illustrated...

    QUESTION 6 Assume you are studying a protein-coding gene, ACEX, which includes 4 exons as illustrated in the gene map below. The 5' UTR and 3' UTR segments are each 25 bp long. Exons 1 thru 4 are 100, 200, 300, 400 bp long, respectively. Each intron is 200 bp each. The locations of the relevant EcoRI sites within the ACEX locus are indicated, but the location of other restriction enzyme sites (like BamHI) are not shown." EcoRI probe EcoRI...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT
ADVERTISEMENT