Can you draw the structure of the peptide sequence, “AWRSME”? What is its net charge at...
Homework Answers
the structure of the given peptide has bee prepared from the given symbols and based on the number of cooh and nh2 groups charge in different conditions has been mentioned;
Add Answer to:
Can
you draw the structure of the peptide sequence, “AWRSME”? What is
its net charge at...
What is the net charge of the molecule with peptide sequence “AWRSME” at a pH of 7.4?
What is the net charge of the molecule with peptide sequence “AWRSME” at a pH of 7.4?
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume...
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume the protein is in solution at physiological pH, and remember to include the amino acids at each end of the chain. A charge may come from the R-group, the N-terminus, and/or the C-terminus. If a residue occurs more than once, include each one in your answer.) List the residues (individual amino acids) that contribute a positive charge: List the residues that contribute a...
Calculate the net charge on the following peptide that contains an intramolecular disufide bond at pH...
Calculate the net charge on the following peptide that contains an intramolecular disufide bond at pH 12. Assume that the peptide and disulfide bonds are stable at this pH. This question does not require you to draw the structure of this peptide, only to calculate the appropriate charge. You must identify where each charge comes from; you can't just give a final net charge number. Show all your work to obtain any-credit. (8 pts) QUESOn Calculate the net charge on...
A peptide has the sequence Glu-His-Trp-Ser-Gly-Leu-Arg-Pro-Gly a)name the peptide b)what is the net charge of the...
A peptide has the sequence Glu-His-Trp-Ser-Gly-Leu-Arg-Pro-Gly a)name the peptide b)what is the net charge of the molecule at Ph 3,8,12 c) Estimate pl
6. A peptide has the sequence Cys-His-Phe-Glu-Ala-Arg a. Write the single letter sequence of the peptide...
6. A peptide has the sequence Cys-His-Phe-Glu-Ala-Arg a. Write the single letter sequence of the peptide b. Calculate the percentage and indicate the charge of the predominant peptide species at pH 6.5. Use the following pKa values: pKa Cys = 8.3, pKa N-terminus = 10.8, pKa His =6.0, pKa Glu = 4.3, pKa Arg = 12.5, pKa C-terminus =2.0 c. What is the charge of the peptide at pH 4.3? d. Draw the chemical structure of the predominant peptide species...
Click the "draw structure" button to launch the drawing utility. Draw the following peptide at physiological...
Click the "draw structure" button to launch the drawing utility.
Draw the following peptide at physiological pH. Lys-trp-pro
edit structure ...
Н н Н Н H3N C N- C -N- C co O C I IZ
8:20 PM Draw the structure of the peptide abbreviated PARTY as it would exist at physiological...
8:20 PM Draw the structure of the peptide abbreviated PARTY as it would exist at physiological pH Calculate the isoelectric point for this peptide. (Use pK values from Table 4-1.) 4.
An amino acid does not contain an ionizable side chain. What will be its net charge...
An amino acid does not contain an ionizable side chain. What will be its net charge at physiological pH, if the amino acid is free (not in a peptide)? oo 0+1 0-1 cannot be determined
what is the net charge of the following amino acid? Draw the corresponding structure. 1. Serine...
what is the net charge of the following amino acid? Draw the corresponding structure. 1. Serine at 5.8 2.Isoleucine at pH 1.0 and can you explain if there is math to do or how would I get the structure for different pH
Click the "draw structure" button to launch the drawing utility. Draw the following peptide at physiological...
Click the "draw structure" button to launch the drawing
utility.
Draw the following peptide at physiological
pH.
Gln-ser-his
Н н Н Н H3N C N- C -N- C co O C I IZ
Calculate the net charge on the following peptide that contains an intramolecular disufide bond at pH 12. Assume that the peptide and disulfide bonds are stable at this pH. This question does not require you to draw the structure of this peptide, only to calculate the appropriate charge. You must identify where each charge comes from; you can't just give a final net charge number. Show all your work to obtain any-credit. (8 pts) QUESOn Calculate the net charge on...
6. A peptide has the sequence Cys-His-Phe-Glu-Ala-Arg a. Write the single letter sequence of the peptide b. Calculate the percentage and indicate the charge of the predominant peptide species at pH 6.5. Use the following pKa values: pKa Cys = 8.3, pKa N-terminus = 10.8, pKa His =6.0, pKa Glu = 4.3, pKa Arg = 12.5, pKa C-terminus =2.0 c. What is the charge of the peptide at pH 4.3? d. Draw the chemical structure of the predominant peptide species...
Click the "draw structure" button to launch the drawing utility.
Draw the following peptide at physiological pH. Lys-trp-pro
edit structure ...
Н н Н Н H3N C N- C -N- C co O C I IZ
8:20 PM Draw the structure of the peptide abbreviated PARTY as it would exist at physiological pH Calculate the isoelectric point for this peptide. (Use pK values from Table 4-1.) 4.
An amino acid does not contain an ionizable side chain. What will be its net charge at physiological pH, if the amino acid is free (not in a peptide)? oo 0+1 0-1 cannot be determined
Click the "draw structure" button to launch the drawing
utility.
Draw the following peptide at physiological
pH.
Gln-ser-his
Н н Н Н H3N C N- C -N- C co O C I IZ
Most questions answered within 3 hours.
-
The free energy change for the following reaction at 25 °C, when
[Sn2+] = 1.17 M...
asked 1 hour ago -
An MNE is this kind of industry when competition in one country
is essentially independent of...
asked 2 hours ago -
. For this set of questions, determine what
proportion of a normal distribution is located betweeneach...
asked 3 hours ago -
A college student is employed as a door-to-door newspaper
salesman. Historical data suggests that the student...
asked 4 hours ago -
MATLAB HW 11 problem using Switch Case and Input commands
Write a script file that calculates...
asked 4 hours ago -
Considering gravitational time dilation, calculate the time that
passes in Earth’s surface while 1 hour passes...
asked 4 hours ago -
Minitab Problem: Take the Lake Hume June rainfall data and find
use the processes outlined in...
asked 5 hours ago -
X Company is trying to decide whether to continue using old
equipment to make Product A...
asked 5 hours ago -
IN PYTHON ONLY !! Program 2: Re-work
program #5 (WeeklyHours) from the previous assignment such that...
asked 6 hours ago -
The average length of time between arrivals at a turnpike
toll-booth is 26 seconds. What is...
asked 7 hours ago -
(a) A piston at 6.1 atm contains a gas that occupies a volume of
3.5 L....
asked 9 hours ago -
Please answer true or false. Words
cannot be changed or added in to make it true...
asked 9 hours ago