Homework Answers
The net charge of peptide at pH 12:-
COO-Asn-Glu-Cys-His-Ser-Cys-Lys-NH3+
=pKa of COO- 3. pKa NH3+ 10
IF pKa is greater than pH, protonation occurs and vice versa.
Net charge=. - 1+0-1+0+0-1+0+0+0. = - 3 net charge
Add Answer to:
Calculate the net charge on the following peptide that contains an intramolecular disufide bond at pH...
You are given a peptide Ala-Cys-Leu that is oxidized to form a disulfide bond with another...
You are given a peptide Ala-Cys-Leu that is oxidized to form a disulfide bond with another Ala-Cys-Leu. What is its net charge at pH 12? What is its net charge if the disulfide bonds are reduced?
Hi. Please show work and I will gladly rate! 22. Calculate the net charge on the...
Hi. Please show work and I will gladly rate!
22. Calculate the net charge on the following peptide at pH 8. Arg-Glu-Gln-Asn-Asp-His-Lys-Arg-Glu-Asp
Indicate which of the amino acid residues in the following peptide sequence contains a group that...
Indicate which of the amino acid residues in the following peptide sequence contains a group that has a negative charge for its most likely charge state at pH 10. Phe-Val-Pro-His-Trp-Asn-Cys-Thr-Asp Please explain in detail how you got the answer. thank you!
-2. Which of the following tripeptides would carry a net charge of-1 at pH 7? Markallthatapply....
-2. Which of the following tripeptides would carry a net charge of-1 at pH 7? Markallthatapply. (3 pts.) A. Asp-Ala-Arg C. Lys-Gly-Asn D. Glu-Lys-Asp E. Leu-Asp-Glu F. Arg-lleu-Cys B. Met-Pro-Glu The Kd for a dimeric protein complex is 2.2 μM. (3 pts.) Mark all that are true about this dimeric protein complex. A. 3. At equilibrium, the concentration of the individual subunits is very, very low. B. If this is a homodimer, it can be called an αβ dimer. C....
What is the approximate net charge of the following pentapeptide at pH 10? Arg-Gln-Cys-His-Ala What is...
What is the approximate net charge of the following pentapeptide at pH 10? Arg-Gln-Cys-His-Ala What is the Isoelectric point (pI) of the peptide given above? Use the pKa values given here when needed: Side group/ amino acid pKa Asp 3.9 Glu 4.1 HIs 6.0 Cys 8.4 Tyr 10.5 Lys 10.5 Arg 12.5 C-term 3.5 N-term 9.0
19. Calculate the net charge on the following nonapeptide at the physiological pH 7.4, and predict...
19. Calculate the net charge on the following nonapeptide at the physiological pH 7.4, and predict the peptide's mobility in an electric field. Explain your answer. (4 pts) Gln-Tyr-Ala-Phe-Gly-Cys-Ser-His-Asp.
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume...
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume the protein is in solution at physiological pH, and remember to include the amino acids at each end of the chain. A charge may come from the R-group, the N-terminus, and/or the C-terminus. If a residue occurs more than once, include each one in your answer.) List the residues (individual amino acids) that contribute a positive charge: List the residues that contribute a...
Calculate the net charge of arginine (pK1=2.17, pK2=9.04, pK3=12.48) at pH 6.0. In order to calculate...
Calculate the net charge of arginine (pK1=2.17, pK2=9.04, pK3=12.48) at pH 6.0. In order to calculate the net charge you must first calculate the percent “charged” for each ionizable functional group in the chemical structure of arginine. Use four significant digits in your calculation of the net charge.
#1) For the following pentapeptide (Where pH =1): a) What would the net charge be for...
#1) For the following pentapeptide (Where pH =1):
a) What would the net charge be for the following pH?
pH 0 =
pH 3 =
pH 5 =
pH 7 =
pH 10 =
pH 13 =
b) Calculate the pl of the pentapeptide. (Cysteine: pK1 = 1.96,
pK2 = 10.128) ( Glutamine: pK1 = 2.17 , pK2 = 9.13) (Arginine: pK1
= 2.17. pK2 = 9.04) (Leucine: pK1 = 2.36 , pK2 = 9.60)
c) If you were to...
(18 pts) Answer True or False for each of the following questions (a) An amino acid...
(18 pts) Answer True or False for each of the following questions (a) An amino acid is in the zwitterionic form only if the pll is well below 7 (b) Salting out takes advantage of the fact that the solubility of proteins varies with concentration. (c) Proteins usually consists of amino acids of both L-isomers (d) Essentially all a-helices found in proteins are left-handed globular protein is thermodynamically the most stable structure. ( Isoclectric focusing can be used to separate...
Hi. Please show work and I will gladly rate!
22. Calculate the net charge on the following peptide at pH 8. Arg-Glu-Gln-Asn-Asp-His-Lys-Arg-Glu-Asp
-2. Which of the following tripeptides would carry a net charge of-1 at pH 7? Markallthatapply. (3 pts.) A. Asp-Ala-Arg C. Lys-Gly-Asn D. Glu-Lys-Asp E. Leu-Asp-Glu F. Arg-lleu-Cys B. Met-Pro-Glu The Kd for a dimeric protein complex is 2.2 μM. (3 pts.) Mark all that are true about this dimeric protein complex. A. 3. At equilibrium, the concentration of the individual subunits is very, very low. B. If this is a homodimer, it can be called an αβ dimer. C....
19. Calculate the net charge on the following nonapeptide at the physiological pH 7.4, and predict the peptide's mobility in an electric field. Explain your answer. (4 pts) Gln-Tyr-Ala-Phe-Gly-Cys-Ser-His-Asp.
#1) For the following pentapeptide (Where pH =1):
a) What would the net charge be for the following pH?
pH 0 =
pH 3 =
pH 5 =
pH 7 =
pH 10 =
pH 13 =
b) Calculate the pl of the pentapeptide. (Cysteine: pK1 = 1.96,
pK2 = 10.128) ( Glutamine: pK1 = 2.17 , pK2 = 9.13) (Arginine: pK1
= 2.17. pK2 = 9.04) (Leucine: pK1 = 2.36 , pK2 = 9.60)
c) If you were to...
(18 pts) Answer True or False for each of the following questions (a) An amino acid is in the zwitterionic form only if the pll is well below 7 (b) Salting out takes advantage of the fact that the solubility of proteins varies with concentration. (c) Proteins usually consists of amino acids of both L-isomers (d) Essentially all a-helices found in proteins are left-handed globular protein is thermodynamically the most stable structure. ( Isoclectric focusing can be used to separate...
Most questions answered within 3 hours.
-
A solid, uniform disk of radius 0.250 m and mass 53.7 kg rolls
down a ramp...
asked 45 minutes ago -
Given the following table of high speed internet access vs.
annual home income:
Home Income
%...
asked 1 hour ago -
A baseball batter hits a 0.145kg baseball straight up into the
air. The baseball leaves the...
asked 1 hour ago -
An FM modulator is tested using
single-tone baseband signal with frequency of 50kHz and a sprectrum...
asked 2 hours ago -
Write the ionic equations for the first stage of salts
hydrolysis.
Anion, Cation?
Na2S
NiSO4
K2SO4...
asked 3 hours ago -
suppose there is a normally distributed population with a mean of
250 and a standard deviation...
asked 4 hours ago -
Question Three
Suppose you as project manager are using the Waterfall
development methodology on a large...
asked 5 hours ago -
Which statement is not true about welfare in Canada?
A.Benefits typically vary based on one's ability...
asked 5 hours ago -
Please help me with FLOWCHART and UML diagram for class,
thank you!
#include <iostream>
#include <fstream>...
asked 6 hours ago -
3. Describe the “logic circuit” of the Lac operon. Which
proteins are bound or not to...
asked 6 hours ago -
Ayesha’s adjusted gross income is $60,000 in 2019. She donated a
piece of artwork with a...
asked 6 hours ago -
For Dijkstra’s shortest path algorithm:
a. Give the Big-O time for Dijkstra’s shortest path algorithm
and...
asked 6 hours ago