Question

A scientist is conducting a Sanger's sequencing experiment to determine the number of polypeptides present in...

A scientist is conducting a Sanger's sequencing experiment to determine the number of polypeptides present in an oligomeric protein. The molecular weight of the protein is 18000 g/mol . After the reaction of 520 mg of the protein with 1‑fluoro‑2,4‑dinitrobenzene, the peptide bonds were hydrolyzed with an acid. As a result, the scientist obtained 39 mg of 2,4‑dinitrophenyl serine. What is the number of the polypeptide chains present in the oligomer?

0 0
Add a comment Improve this question Transcribed image text
Answer #1

1-horo-2, 4- dimitro bengene meaet buth a forodues alinitro pheny! fatlncing aunin o manner amino aei dl an NUr NH. N* + (ONNow anume that theno n m exeept Nrbrmin o na Ane, Ser ine n N-temuno aminoasd df eae peptide Wumber o Aaf tele cham paphia

Add a comment
Know the answer?
Add Answer to:
A scientist is conducting a Sanger's sequencing experiment to determine the number of polypeptides present in...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...

    A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT
ADVERTISEMENT