A scientist is conducting a Sanger's sequencing experiment to determine the number of polypeptides present in an oligomeric protein. The molecular weight of the protein is 18000 g/mol . After the reaction of 520 mg of the protein with 1‑fluoro‑2,4‑dinitrobenzene, the peptide bonds were hydrolyzed with an acid. As a result, the scientist obtained 39 mg of 2,4‑dinitrophenyl serine. What is the number of the polypeptide chains present in the oligomer?
A scientist is conducting a Sanger's sequencing experiment to determine the number of polypeptides present in...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...