4,2,7,6 please explain where
these numbers come from
Homework Answers
Add Answer to:
4,2,7,6 please explain where
these numbers come from
Question 11 (10 pts) The structure at the...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
Find the two other segments of the sequence among your classmates that will complete the protein....
Find the two other segments of the sequence among your classmates that will complete the protein. For example if you have a middle segment you will need to find a beginning and an end segment. Write the entire linear order of amino acids in Part 2, Question l in your proforma, (using the single letter amino acid abbreviation). Start with the beginning segment, followed by the middle segment and lastly, the end segment. Indicate the amino (NH2) and carboxyl (COOH)...
Do you think it is possible to exploit the biological process of protein synthesis to make...
Do you think it is possible to exploit the biological process of
protein synthesis to make human proteins in the lab? What would you
need to do this? Describe the general process you would need to
follow to accomplish this goal.
NATIONAL CENTER FOR CASE STUDY TEACHING IN SCIENCE Part lIl Chemical Synthesis of Human Insulin - Close, but no Cigar In order to meet the increasing demands for insulin, and to eliminate the adverse side effects of animal insulin,...
60) Lipids are composed of: c) fatty acids and glycerol amino acids and glycerol nucleic acids...
60) Lipids are composed of: c) fatty acids and glycerol amino acids and glycerol nucleic acids and glycerol fatty acids and water fatty acids and sugar e) 61) The bond between two amino acids is a: a) hydrogen bond b) covalent bond c) peptide bond d) b and c e) none of the above 62) Hemoglobin has which tertiary structure: a) fibrous b) globular c) four subunits--two alpha chains, two beta chains d) alpha helix e) none of the above...
Could I have some help with these please? Q1. (10 pts) Draw the peptide Phe-Gly-Met-Tyr from...
Could I have some help with these please? Q1. (10 pts) Draw the peptide Phe-Gly-Met-Tyr from C→ N. A) How many peptide bonds does this structure have? B) If you apply cyanogen bromide to this peptide, what would be the products of final peptide? Write them as three letter amino acids. Q2. (10 pts). Write the products of the following biological organic reactions. O O NH O O Solid support CF3COOH CH2Cl2 S S NH O OH NH O OH...
12. Below is a portion of the abstract of a journal article. It describes the isolation,...
12. Below is a portion of the abstract of a journal article. It describes the isolation, purification, and determination of the peptide sequence as well as, the location of each of the disulfide bridges of an antibacterial peptide from the cowpea plant. Give brief and to the point answers to the questions based upon this information. (2 pts) FEBS Joumal 273 (2006) 3489-3497 2006 The Authors Journal compilation2006 FEBS Identification of a cowpea y-thionin with bactericidal activity Octávio L. Franco,...
Review| Constants| Periodic Table Protein structure is conceptually divided into four levels, from most basic to...
Review| Constants| Periodic Table Protein structure is conceptually divided into four levels, from most basic to higher order Primary structure describes the order of amino acids in the peptide chain. Secondary structure describes the basic three-dimensional structures, a-helices and B sheets. Tertiary structure describes how the secondary structures come together to form an individual globular protein. Quatemary structure results from individual proteins coming together to form multi-subunit protein complexes Part A Complete the following vocabulary exercise relating to the level...
please answer 4. Secondary structure (a-helix): The image below is of a polypeptide in secondary (2)...
please answer
4. Secondary structure (a-helix): The image below is of a polypeptide in secondary (2) structure level of protein folding. Specifically it is of an a-helix. Use the image on the left to answer the questions a-e below. The image on the right is to help with question "f' only. a. Name the specific bond/interaction indicated by the dotted lines. b. Is this bond/interaction covalent or non-covalent? c. Is this bond/interaction permanent or transient? d. What parts of the...
23a. TRANSLATION Preparation Due 3-11 Read textbook Sections 17.3-17.5 Please submit your worksheer online (.docx er...
23a. TRANSLATION Preparation Due 3-11 Read textbook Sections 17.3-17.5 Please submit your worksheer online (.docx er yd) or type up the answers to submit Learning Goals a. Compare translation in prokaryotes and eukaryotes. b. Recount the events of translation initiation, elongation, and termination. c. Link ribosomal activity to the secretory pathway. d. Diagram the relationship between a gene, an immature mRNA, a mature mRNA, and a protein. 1. Approximately how many codons are minimally required to encode a polypeptide chain...
1. What do Quanmum numbers indicate and where do they come from? 2. The principal Quantum...
1. What do Quanmum numbers indicate and where do they come from? 2. The principal Quantum number n represents what level of atomic structure and how many electrons are in n=3? 3. What do the orbitals represent? 4. Why is the periodic chart is organized according to Classic Chemical reactivity and orbital structure? 5. Why does Electronegativity increase from left to right and top to bottom? What is the electron configuration of Oxygen and what are the Quantum Numbers for...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
Find the two other segments of the sequence among your classmates that will complete the protein. For example if you have a middle segment you will need to find a beginning and an end segment. Write the entire linear order of amino acids in Part 2, Question l in your proforma, (using the single letter amino acid abbreviation). Start with the beginning segment, followed by the middle segment and lastly, the end segment. Indicate the amino (NH2) and carboxyl (COOH)...
Do you think it is possible to exploit the biological process of
protein synthesis to make human proteins in the lab? What would you
need to do this? Describe the general process you would need to
follow to accomplish this goal.
NATIONAL CENTER FOR CASE STUDY TEACHING IN SCIENCE Part lIl Chemical Synthesis of Human Insulin - Close, but no Cigar In order to meet the increasing demands for insulin, and to eliminate the adverse side effects of animal insulin,...
60) Lipids are composed of: c) fatty acids and glycerol amino acids and glycerol nucleic acids and glycerol fatty acids and water fatty acids and sugar e) 61) The bond between two amino acids is a: a) hydrogen bond b) covalent bond c) peptide bond d) b and c e) none of the above 62) Hemoglobin has which tertiary structure: a) fibrous b) globular c) four subunits--two alpha chains, two beta chains d) alpha helix e) none of the above...
12. Below is a portion of the abstract of a journal article. It describes the isolation, purification, and determination of the peptide sequence as well as, the location of each of the disulfide bridges of an antibacterial peptide from the cowpea plant. Give brief and to the point answers to the questions based upon this information. (2 pts) FEBS Joumal 273 (2006) 3489-3497 2006 The Authors Journal compilation2006 FEBS Identification of a cowpea y-thionin with bactericidal activity Octávio L. Franco,...
Review| Constants| Periodic Table Protein structure is conceptually divided into four levels, from most basic to higher order Primary structure describes the order of amino acids in the peptide chain. Secondary structure describes the basic three-dimensional structures, a-helices and B sheets. Tertiary structure describes how the secondary structures come together to form an individual globular protein. Quatemary structure results from individual proteins coming together to form multi-subunit protein complexes Part A Complete the following vocabulary exercise relating to the level...
please answer
4. Secondary structure (a-helix): The image below is of a polypeptide in secondary (2) structure level of protein folding. Specifically it is of an a-helix. Use the image on the left to answer the questions a-e below. The image on the right is to help with question "f' only. a. Name the specific bond/interaction indicated by the dotted lines. b. Is this bond/interaction covalent or non-covalent? c. Is this bond/interaction permanent or transient? d. What parts of the...
23a. TRANSLATION Preparation Due 3-11 Read textbook Sections 17.3-17.5 Please submit your worksheer online (.docx er yd) or type up the answers to submit Learning Goals a. Compare translation in prokaryotes and eukaryotes. b. Recount the events of translation initiation, elongation, and termination. c. Link ribosomal activity to the secretory pathway. d. Diagram the relationship between a gene, an immature mRNA, a mature mRNA, and a protein. 1. Approximately how many codons are minimally required to encode a polypeptide chain...
1. What do Quanmum numbers indicate and where do they come from? 2. The principal Quantum number n represents what level of atomic structure and how many electrons are in n=3? 3. What do the orbitals represent? 4. Why is the periodic chart is organized according to Classic Chemical reactivity and orbital structure? 5. Why does Electronegativity increase from left to right and top to bottom? What is the electron configuration of Oxygen and what are the Quantum Numbers for...
Most questions answered within 3 hours.
-
Why is the reticulum the affected compartment of the
stomach?
Group of answer choices
It has...
asked 48 seconds from now -
Homework: Create a Class.... from scratch
Design , implement and test a class that can be...
asked 1 minute ago -
A 3.0275 g sample of KHP (a primary standard, 1:1 acid:base,
FM=204.23 g/mol) is titrated with...
asked 5 minutes ago -
1. You need to make an aqueous solution of
0.165 M barium acetate for an
experiment...
asked 5 minutes ago -
Let X be a discrete random variable with the following PMF.
Px(k) =
1/4 for k...
asked 9 minutes ago -
ONLY use the information provided here on the
firm's Mission Statement. Written assessment must include
(1)...
asked 18 minutes ago -
2 Aliases
2a: Create an alias, numberfiles, which prints the number of
files in the current...
asked 26 minutes ago -
Hi so I'm currently using MIT App Inventor to create a app and I
wanted to...
asked 22 minutes ago -
Create a truth table for a 4-bit input where the output will be
a 1, if...
asked 24 minutes ago -
in a taxable acquisition, P corporation, using its own stock and
cash, purchases S corporation. The...
asked 26 minutes ago -
please don't use the p value method instead use the "5 steps of
hypothesis testing." Or...
asked 45 minutes ago -
It is said that Galileo discovered a basic principle of the
pendulum—that the period is independent...
asked 50 minutes ago