4,2,7,6 please explain where
these numbers come from
4,2,7,6 please explain where these numbers come from Question 11 (10 pts) The structure at the...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
Find the two other segments of the sequence among your classmates that will complete the protein. For example if you have a middle segment you will need to find a beginning and an end segment. Write the entire linear order of amino acids in Part 2, Question l in your proforma, (using the single letter amino acid abbreviation). Start with the beginning segment, followed by the middle segment and lastly, the end segment. Indicate the amino (NH2) and carboxyl (COOH)...
Do you think it is possible to exploit the biological process of
protein synthesis to make human proteins in the lab? What would you
need to do this? Describe the general process you would need to
follow to accomplish this goal.
NATIONAL CENTER FOR CASE STUDY TEACHING IN SCIENCE Part lIl Chemical Synthesis of Human Insulin - Close, but no Cigar In order to meet the increasing demands for insulin, and to eliminate the adverse side effects of animal insulin,...
60) Lipids are composed of: c) fatty acids and glycerol amino acids and glycerol nucleic acids and glycerol fatty acids and water fatty acids and sugar e) 61) The bond between two amino acids is a: a) hydrogen bond b) covalent bond c) peptide bond d) b and c e) none of the above 62) Hemoglobin has which tertiary structure: a) fibrous b) globular c) four subunits--two alpha chains, two beta chains d) alpha helix e) none of the above...
Could I have some help with these please? Q1. (10 pts) Draw the peptide Phe-Gly-Met-Tyr from C→ N. A) How many peptide bonds does this structure have? B) If you apply cyanogen bromide to this peptide, what would be the products of final peptide? Write them as three letter amino acids. Q2. (10 pts). Write the products of the following biological organic reactions. O O NH O O Solid support CF3COOH CH2Cl2 S S NH O OH NH O OH...
12. Below is a portion of the abstract of a journal article. It describes the isolation, purification, and determination of the peptide sequence as well as, the location of each of the disulfide bridges of an antibacterial peptide from the cowpea plant. Give brief and to the point answers to the questions based upon this information. (2 pts) FEBS Joumal 273 (2006) 3489-3497 2006 The Authors Journal compilation2006 FEBS Identification of a cowpea y-thionin with bactericidal activity Octávio L. Franco,...
Review| Constants| Periodic Table Protein structure is conceptually divided into four levels, from most basic to higher order Primary structure describes the order of amino acids in the peptide chain. Secondary structure describes the basic three-dimensional structures, a-helices and B sheets. Tertiary structure describes how the secondary structures come together to form an individual globular protein. Quatemary structure results from individual proteins coming together to form multi-subunit protein complexes Part A Complete the following vocabulary exercise relating to the level...
please answer
4. Secondary structure (a-helix): The image below is of a polypeptide in secondary (2) structure level of protein folding. Specifically it is of an a-helix. Use the image on the left to answer the questions a-e below. The image on the right is to help with question "f' only. a. Name the specific bond/interaction indicated by the dotted lines. b. Is this bond/interaction covalent or non-covalent? c. Is this bond/interaction permanent or transient? d. What parts of the...
23a. TRANSLATION Preparation Due 3-11 Read textbook Sections 17.3-17.5 Please submit your worksheer online (.docx er yd) or type up the answers to submit Learning Goals a. Compare translation in prokaryotes and eukaryotes. b. Recount the events of translation initiation, elongation, and termination. c. Link ribosomal activity to the secretory pathway. d. Diagram the relationship between a gene, an immature mRNA, a mature mRNA, and a protein. 1. Approximately how many codons are minimally required to encode a polypeptide chain...
1. What do Quanmum numbers indicate and where do they come from? 2. The principal Quantum number n represents what level of atomic structure and how many electrons are in n=3? 3. What do the orbitals represent? 4. Why is the periodic chart is organized according to Classic Chemical reactivity and orbital structure? 5. Why does Electronegativity increase from left to right and top to bottom? What is the electron configuration of Oxygen and what are the Quantum Numbers for...