Do you think it is possible to exploit the biological process of protein synthesis to make human proteins in the lab? What would you need to do this? Describe the general process you would need to follow to accomplish this goal.
With the 8ntroduction of the field of genetic engineering, it has become possible to synthesise protiens outside body in vivo.
The first gene product that was produced through genetic engineering was a protien, human insulin with the aim to treat diabetes.
A rod shaped bacteria called E. Coli is used for the synthesis of this protien. These bacteria were grown in laboratory and human insulin gene was transferred into the bacteria through recombinant DNA technology. Bacteria was able to express the gene and synthesise insulin. These bacteria are grown in bioreactors for the large scale production of insulin which is then extracted from these bioreactors, purified, processed and is finally made ready for use.
Therefore protiens can be synthesised in laboratory. The various steps involved are.
1. Finding the gene that encodes the protien to be synthesised.
2. Cutting the gene by the help of specific restriction enzymes and pasting it in a suitable vector to form.recombinant DNA.
3. This recombinant DNA is transferred into a suitable host such as E. Coli.
Now E.coli is ready to synthesise the protien.
One of the important jobs for the biotechnologist is to create the perfect environment for the cells to grow and thrive. Nutrients and oxygen must be delivered in exact quantities, the optimum temperature and pH must be maintained, and waste products must be removed.
The cells that are going to produce the protein need to be able to be grown in large amounts. Bioreactors are used to grow cells under conditions where they will make proteins. A bioreactor provides cells with all the substances they need to grow and reproduce.
Do you think it is possible to exploit the biological process of protein synthesis to make...
Lab #14 Protein Synthesis Introduction Proteins are vital for the survival of an organism. Proteins make enzymes and hormones which control reactions that must take place in the cell to survive.Proteins are made of basic units called amino acids. There are a total of 20 amino acids. Different proteins have different number and/or combination of amino acids. The kind of amino acid that is used when producing the protein depends on the 3-base code (codon) read from the RNA molecule...
Find the two other segments of the sequence among your classmates that will complete the protein. For example if you have a middle segment you will need to find a beginning and an end segment. Write the entire linear order of amino acids in Part 2, Question l in your proforma, (using the single letter amino acid abbreviation). Start with the beginning segment, followed by the middle segment and lastly, the end segment. Indicate the amino (NH2) and carboxyl (COOH)...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2 Gene 1 Gene 3 DNA strand3 TRANSLATION Protein Trp Gly Model 2 ACTIVITY and QUESTIONS 1. Based on the information you can gather from model 1 complete the following sentences: a. The nucleotide Adenine (A) always pairs with the nucleotide b. The nucleotide Guanine (G) always pairs with the...
Sequence Comparisons Proteins called molecular chaperones (described in Chapter 4) assist in the process of protein folding. One class of chaperone found in organisms from bacteria to mammals is heat shock protein 90 (Hsp90). All Hsp90 chaperones contain a 10 amino acid "signature sequence," which allows for ready identification of these proteins in sequence databases. Two representations of this signature sequence are shown below. (a) In this sequence, which amino acid residues are invariant (conserved across all species)? (b) At...
When you drink a cup of milk, what happens to the protein in the milk after it has been swallowed? To describe these processes, you must be able to use the vocabulary effectively. FILL IN THE BLANKS tripeptide is the active form of a digestive enzyme in the stomach that breaks polypeptide chains into smaller acid group polypeptides. dipeptide 2. Cleavage of proteins by pepsin in the stomach results in formation of which get broken down amino acids further in...
6. (4) You are trying to make a synthetic copy of a particular protein but accidentally join the amino acids together in exactly the reverse order. One of your classmates says the two proteins must be identical, and bets you $20 that your synthetic protein will have exactly the same biological activity as the original. After having read this chapter, you have no hesitation in staking your $20 that it won’t. What particular feature of a polypeptide chain makes you...
please help me type my introduction for my lab report. thank you!! INTRODUCTION In this section, you will introduce the experiment by explaining generally what you did and why you did it. This section usually starts with an examination of the literature through a library search to inform the reader about work already done on this topic. If you have never done a bibliographic database search for scientific journal articles, then you are not yet a biological sciences major (note:...
O ACTIVITY 5.4.1 Synthesis of a Protein: A Simulation Activity In this activity, you will be provided with the DNA nucleotide sequence that codes for a hypothetical protein. The code will be provided to you in three fragments. You will have to tran- scribe the code into mRNA, remove an intron segment, and translate the mRNA into the protein. In addition, you will have to identify the beginning fragment the middle fragment, and the end fragment. Sequence A TCTTCCCTCCTAAACGTTCAACCGGTTCTTAATCCGC CGCCAGGGCCCCGCCCCTCAGAAGTTGGT...
Place these events that occur during protein synthesis in the proper sequence - I. II. III. IV. An aminoacyl-tRNA binds to the A site - I. II. III. IV. A peptide bond forms between the new amino acid and a polypeptide chain - I. II. III. IV. ...