Question

The human protein coding gene frt has three exons. A mutation at the splice junction between the second exon and first intron
0 0
Add a comment Improve this question Transcribed image text
Answer #1

Exon 1 Intron 1 Exon 2 Introna Exon3 ? Mutation at to Hemone C all to going offect first are this spice sile lead to inabilit

Add a comment
Know the answer?
Add Answer to:
The human protein coding gene frt has three exons. A mutation at the splice junction between...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • The human protein coding gene frt has three exons. A mutation at the splice junction between...

    The human protein coding gene frt has three exons. A mutation at the splice junction between the second exon and first intron leads to an inability to remove a DNA segment during splicing. Which of the following is describes the most likely outcome(s) of this mutation: termination of translation within the coding sequence of the second exon termination of transcription within the coding sequence of the second intron termination of transcription before the coding sequence of the second exon termination...

  • A eukaryotic protein-encoding gene has three introns and 4 exons. A splicing repressor commonly binds to...

    A eukaryotic protein-encoding gene has three introns and 4 exons. A splicing repressor commonly binds to the 3' end of the second intron (introns 2/ exon three splice sites) draw the mRNA strand before and after splicing Diagram a final functional eukaryotic mRNA molecule from the 5' end to 3' end. There should be 7 items labeled in the diagram.

  • QUESTION 6 Assume you are studying a protein-coding gene, ACEX, which includes 4 exons as illustrated...

    QUESTION 6 Assume you are studying a protein-coding gene, ACEX, which includes 4 exons as illustrated in the gene map below. The 5' UTR and 3' UTR segments are each 25 bp long. Exons 1 thru 4 are 100, 200, 300, 400 bp long, respectively. Each intron is 200 bp each. The locations of the relevant EcoRI sites within the ACEX locus are indicated, but the location of other restriction enzyme sites (like BamHI) are not shown." EcoRI probe EcoRI...

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

  • 21. One form of thalassemia has a single G->A mutation in the B-globin gene at the...

    21. One form of thalassemia has a single G->A mutation in the B-globin gene at the first nucleotide in the intron. This destroys the S' splice junction. The mRNA remains unspliced, leaving nucleotide intron in place. Assuming no stop codons are introduced in the intron pro second exon would be in-frame or out of frame in the translated protein dict if the A. In frame B. Out of frame Phe Ser Ty Cys U Phe Ser Cys Leu Se Stop...

  • please answer all 6 questions Question 27 3 pts TRBP is a protein important for the...

    please answer all 6 questions Question 27 3 pts TRBP is a protein important for the formation of the RISC complex. Which of the following would you expect in cells with null mutations in TRBP? o Reduced siRNA-mediated mRNA degradation o Increased miRNA-mediated translational repression o Increased deadenylase-mediated mRNA degradation o Reduced proteasome-mediated protein degradation D Question 28 3 pts A protein that binds to the 3' UTR of a VEGF mRNA and promotes deadenylation and uncapping is likely to:...

  • Below is a series of events involved in the mechanism of forming a retrotransposon. Place these...

    Below is a series of events involved in the mechanism of forming a retrotransposon. Place these steps in the correct order 1. the DNA copy is made double-stranded 2. DNA of the transposable element is transcribed 3. The DNA of the transposable element is integrated into a target DNA site 4. The RNA is reverse transcribed by reverse transcriptase, producing a complementary DNA 4,2,3,1 3,2,4,1 2,4,1,3 4,2,1,3 1,2,3,4 What is the function of the poly(A) tail on most mRNAs To...

  • Since the 1980s, HIV (Human Immunodeficiency Virus) has been infecting humans around the world causing the...

    Since the 1980s, HIV (Human Immunodeficiency Virus) has been infecting humans around the world causing the condition known as AIDS (Acquired Immune Deficiency Syndrome). HIV, like all viruses, needs to enter cells and use their machinery to reproduce and spread. During HIV infection, the virus enters specific cells of the immune system (T-cells) by "docking" onto cell surface proteins, including one called CCR5 Genetic analysis of individuals who are naturally immune (resistant) to HIV have revealed that resistance to HIV...

  • Please answer all questions. Oftentimes, unsaturated fatty acids are found in a fluid state at room...

    Please answer all questions. Oftentimes, unsaturated fatty acids are found in a fluid state at room temperature (e.g., olive oil). This is because unsaturated fatty acids contain a large number of ___________________. a. Hydrogen bonds b. Carbon-Carbon single bonds c. Carbon-Carbon double bonds d. Sulfide bonds e. Radioactive bonds Which of the following stages of aerobic cellular respiration generates the most ATP? a. Glycolysis b. Pyruvate breakdown c. Citric Acid Cycle (aka. Krebs Cycle) d. Oxidative phosphorylation e. Calvin Cycle...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT
ADVERTISEMENT