Looking for help with more 2(b) and 2(c).
Homework Answers
Summary: Polymerization is the process by which the Monomers combines together through Bond Formation to form a Polymer of Different Sizes depending upon the Number of Monomers.
Note: Please like if you are satisfied with the Answer.
Add Answer to:
Looking for help with more 2(b) and 2(c).
Question 2. (a) Why would the following monomer...
Question 10 (10 pts) Peptides are biological oligomers formed by condensing multiple amino acids into an...
Question 10 (10 pts) Peptides are biological oligomers formed by condensing multiple amino acids into an amide backbone. Although this amide backbone is common to all peptides, the so- called 'side-chan' groups attached to this backbone vary depending the amino acids used in the condensation reaction. Shown below are four different tetrapeptides (so-named because they are the products of the condensation of four amino acids). Based on their structures, predict the order of elution that one might expect if separating...
The chemical structures of the 20 standard amino acids at pH 7, along with their 3...
The chemical structures of the 20 standard amino acids at pH 7, along with their 3 and 1 letter codes, are givern in alphabetical order below. While the oxygen and nitrogen atoms of the peptide bonds may serve as a donor atom to complex a metal ion, very often the ligands for the metal come from the amino acid side chains. Takea few moments to examine the chemical structures of the different side chains. Circle the side chains that you...
C,D, and E i need help with. 17. The following peptide forms part of Human Hemoglobin...
C,D, and E i need help with.
17. The following peptide forms part of Human Hemoglobin subunit gammaa Asp-Leu-Lys-Gly-Thr-Phe-Ala A) Which amino acids are likely to be on the side of peptid acids are likely to be on the side of peptide that faces the interior of the protein? Insert your answer leu, Gto.Pne, Ala B) Which are likely to be facing the aqueous environment? Insert your answer Asp, lys, Thr Draw the structure of the sequence at pH7.4. Using...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
11.Which of the following mutations would most likely to disrupt the structure of an α-helix? Cys...
11.Which of the following mutations would most likely to disrupt the structure of an α-helix? Cys to Ala Lys to Arg Glu to Gly Val to Leu 12.Which amino acid combination is the most preferred to occupy positions 1 and 4 in an α-helix? Glu and Lys Phe and Pro Lys and Arg Asp and Glu 13.If each turn in the standard alpha helix extends 5.4 A and there are 3.6 amino acid residues per turn, how many amino acids...
15. Which is used to reduce the disulfide bonds in proteins? D) iodoacetate B) performic acid C) DTT A) PITC 16. Wh...
15. Which is used to reduce the disulfide bonds in proteins? D) iodoacetate B) performic acid C) DTT A) PITC 16. What is the net charge on the tripeptide Gly-Asp-Lys at pH 1.5? The table below gives the pKa's of the ionizable groups on the free amino acids. Free amino acid pK, of a-Carboxyl pKs of side chain pKa of a-amino group 2.4 group 9.8 Glycine Aspartate Lysine 2.0 3.9 9.9 2.2 9.1 10.5 A) -2 B) C) D) +2...
please help me type my introduction for my lab report. thank you!! INTRODUCTION In this section,...
please help me type my
introduction for my lab report. thank you!!
INTRODUCTION In this section, you will introduce the experiment by explaining generally what you did and why you did it. This section usually starts with an examination of the literature through a library search to inform the reader about work already done on this topic. If you have never done a bibliographic database search for scientific journal articles, then you are not yet a biological sciences major (note:...
Namer A) alternating sugar and nitrogen bases liked by peptide bonds B) complimentary bases held ...
Namer A) alternating sugar and nitrogen bases liked by peptide bonds B) complimentary bases held together by hydrogen bonds 6) The backbone of a niacleic acid strand consists of: alternating sugar and phosphate groups linked by phosphate ester bonds D) alternating nitrogen bases and phosphate groups linked by amide bonds Q 7) 刁what amino acids are involved in the following tripeptide? NH-CH-C-NH-CH-- CH NH OH D) His-Lys-Phe A) Tyr-His-Lys C) Lys-His-Tyr B) Lys-His-Phe 8) Which list contains only neutral polar...
Hello please please help !! Thank you!! Please and thank you soo much!!! Question Completion Status:...
Hello please please help !! Thank you!!
Please and thank you soo
much!!!
Question Completion Status: Question 10: The genetic code consists of 64 triplets of nucleotides (called codons). Each codon (with the exception of the 3 stop codons) encodes for one of the 20 amino acids used in the synthesis of proteins. This produces some redundancy in the code as most amino acids are encoded by more than one codon. One codon, AUG serves two related functions: it signals...
accordingly answer and i pt): Polymers and Monomers. Read each question chemical structure, in a oymer chemical structure based on the polymer name and provide the monomer unit chemical st...
accordingly answer and i pt): Polymers and Monomers. Read each question chemical structure, in a oymer chemical structure based on the polymer name and provide the monomer unit chemical structure, in addition. Lastly applications. An example answer is provided as guidance. , provide an example of how the polymers are utilized in (bio)engineering Polymer Chemical Structure Polymer Full Name and Abbreviation Usage Example for Monomer Unit Structure(s) _ _pt per box) pt per box) pt per box) Nucleic Acid (DNA)...
Question 10 (10 pts) Peptides are biological oligomers formed by condensing multiple amino acids into an amide backbone. Although this amide backbone is common to all peptides, the so- called 'side-chan' groups attached to this backbone vary depending the amino acids used in the condensation reaction. Shown below are four different tetrapeptides (so-named because they are the products of the condensation of four amino acids). Based on their structures, predict the order of elution that one might expect if separating...
The chemical structures of the 20 standard amino acids at pH 7, along with their 3 and 1 letter codes, are givern in alphabetical order below. While the oxygen and nitrogen atoms of the peptide bonds may serve as a donor atom to complex a metal ion, very often the ligands for the metal come from the amino acid side chains. Takea few moments to examine the chemical structures of the different side chains. Circle the side chains that you...
C,D, and E i need help with.
17. The following peptide forms part of Human Hemoglobin subunit gammaa Asp-Leu-Lys-Gly-Thr-Phe-Ala A) Which amino acids are likely to be on the side of peptid acids are likely to be on the side of peptide that faces the interior of the protein? Insert your answer leu, Gto.Pne, Ala B) Which are likely to be facing the aqueous environment? Insert your answer Asp, lys, Thr Draw the structure of the sequence at pH7.4. Using...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
15. Which is used to reduce the disulfide bonds in proteins? D) iodoacetate B) performic acid C) DTT A) PITC 16. What is the net charge on the tripeptide Gly-Asp-Lys at pH 1.5? The table below gives the pKa's of the ionizable groups on the free amino acids. Free amino acid pK, of a-Carboxyl pKs of side chain pKa of a-amino group 2.4 group 9.8 Glycine Aspartate Lysine 2.0 3.9 9.9 2.2 9.1 10.5 A) -2 B) C) D) +2...
please help me type my
introduction for my lab report. thank you!!
INTRODUCTION In this section, you will introduce the experiment by explaining generally what you did and why you did it. This section usually starts with an examination of the literature through a library search to inform the reader about work already done on this topic. If you have never done a bibliographic database search for scientific journal articles, then you are not yet a biological sciences major (note:...
Namer A) alternating sugar and nitrogen bases liked by peptide bonds B) complimentary bases held together by hydrogen bonds 6) The backbone of a niacleic acid strand consists of: alternating sugar and phosphate groups linked by phosphate ester bonds D) alternating nitrogen bases and phosphate groups linked by amide bonds Q 7) 刁what amino acids are involved in the following tripeptide? NH-CH-C-NH-CH-- CH NH OH D) His-Lys-Phe A) Tyr-His-Lys C) Lys-His-Tyr B) Lys-His-Phe 8) Which list contains only neutral polar...
Hello please please help !! Thank you!!
Please and thank you soo
much!!!
Question Completion Status: Question 10: The genetic code consists of 64 triplets of nucleotides (called codons). Each codon (with the exception of the 3 stop codons) encodes for one of the 20 amino acids used in the synthesis of proteins. This produces some redundancy in the code as most amino acids are encoded by more than one codon. One codon, AUG serves two related functions: it signals...
accordingly answer and i pt): Polymers and Monomers. Read each question chemical structure, in a oymer chemical structure based on the polymer name and provide the monomer unit chemical structure, in addition. Lastly applications. An example answer is provided as guidance. , provide an example of how the polymers are utilized in (bio)engineering Polymer Chemical Structure Polymer Full Name and Abbreviation Usage Example for Monomer Unit Structure(s) _ _pt per box) pt per box) pt per box) Nucleic Acid (DNA)...
Most questions answered within 3 hours.
-
Hydrobromic acid
dissolves solid iron according to the followiaung reaction:
Fe(s)+2HBr(aq)→
FeBr2(aq)+ H2(g)
Part A. What...
asked 1 hour ago -
Verify the following vector identity in SPHERICAL
COORDINATES.
div(curl(A)) = 0
asked 3 hours ago -
The work function (Φ) for a metal is 7.50×10-19 J.
What is the longest wavelength (nm)...
asked 4 hours ago -
1. Would the following procedural changes cause the
calculated mass percent Ni2+ ion in Ni(NH3)nCl2 to...
asked 5 hours ago -
1. Why does the voltage of the capacitor vary with frequency?
where does this missing voltage...
asked 6 hours ago -
p p please write each step out clearly
3. A manager of a company is considering...
asked 5 hours ago -
On October 1, Ebony Ernst organized Ernst Consulting; on October
3, the owner contributed $83,540 in...
asked 6 hours ago -
A.)As an electron moves through a region of space, its speed
decreases from 9.60 × 106...
asked 7 hours ago -
In java with the netbeans program do:
Through object programming
Create a class "ContadorP", which is...
asked 7 hours ago -
Pattern Corporation acquired all of Science
Company's outstanding stock on January 1, 2016 for $600,000 cash....
asked 7 hours ago -
Here are all accounts Tyler Co. maintains.
Tax expenses $4,750
Common stocks $48,840
SG&A expenses $2,500...
asked 7 hours ago -
Lis
out the types and equation of wind profile and the respective
variables in the fds...
asked 7 hours ago