A friend returns from a trip to the Himalayas convinced that she has found evidence of a Yeti (i.e. the abominable snowman). As proof, she hands you an oddly shaped piece of bone.
While you appreciate her enthusiasm, you are not convinced. So, you do what any young scientist would do and analyze the protein composition of the bone using mass spectroscopy. In doing so, you identify a small protein sequence with the following amino acids: GSTGEIGPAGPPGPPGLR
A) Based on your analysis, what protein did you identify?
B) From what species does this protein derive?
C) What is the common name for this species and does it make sense that she would have found such a bone on her recent trip?
D) What is the complete amino acid sequence of this protein?
E) What is the molecular weight of the protein?
A. The protein identified is Collagen. (High abundance of glycine and proline indicates collagen)
B. The protein derives from Ovies aries (may be present in other ruminants like cow also)
C. Common name for this species is sheep which is found abundantly in snowy mountain region like the Himalayas. So its pretty common to find a bone of sheep in these regions.
D. Complete amino acid sequence in FASTA format is as follows:
>tr|W5P481|W5P481_SHEEP Collagen type I alpha 1 chain OS=Ovis
aries OX=9940 GN=COL1A1 PE=4 SV=1
MFSFVDLRLLLLLAATALLTHGQEEGQEEGQEEDIPPVTCVQNGLRYHDRDVWKPVPCQI
CVCDNGNVLCDDVICDELKDCPNAKVPTPPRPVSPHPPPPPPPPTTTKQRGGRGGPCPRP
GAHRPSHSPPQGPAGPPGRDGIPGQPGLPGPPGPPGPPGPPGLGGNFAPQLSYGYDEKST
GISVPGPMGPSGPRGLPGPPGAPGPQGFQGPPGEPGEPGASGPMGPRGPPGPPGKNGDDG
EAGKPGRPGERGPPGPQGARGLPGTAGLPGMKGHRGFSGLDGAKGDAGPAGPKGEPGSPG
ENGAPGQMGPRGLPGERGRPGAPGPAGARGNDGATGAAGPPGPTGPAGPPGFPGAVGAKG
EAGPQGPRGSEGPQGVRGEPGPPGPAGAAGPAGNPGADGQPGAKGANGAPGIAGAPGFPG
ARGPSGPQGPSGPPGPKGNSGEPGAPGSKGDTGAKGEPGPTGIQGPPGPAGEEGKRGARG
EPGPAGLPGPPGERGGPGSRGFPGSDGVAGPKGPAGERGAPGPAGPKGSPGEAGRPGEAG
LPGAKGLTGSPGSPGPDGKTGPPGPAGQDGRPGPPGPPGARGQAGVMGFPGPKGAAGEPG
KAGERGVPGPPGAVGPAGKDGEAGAQGPPGPAGPAGERGEQGPAGSPGFQGLPGPAGPPG
EAGKPGEQGVPGDLGAPGPSGARGERGFPGERGVQGPPGPAGPRGANGAPGNDGAKGDAG
APGAPGSQGAPGLQGMPGERGAAGLPGPKGDRGDAGPKGADGAPGKDGVRGLTGPIGPPG
PAGAPGDKGETGPSGPAGPTGARGAPGDRGEPGPPGPAGFAGPPGADGQPGAKGEPGDAG
AKGDAGPPGPAGPAGPPGPIGNVGAPGPKGARGSAGPPGATGFPGAAGRVGPPGPSGNAG
PPGPPGPAGKEGSKGPRGETGPAGRAGEVGPPGPPGPAGEKGAPGADGPAGAPGTPGPQG
IAGQRGVVGLPGQRGERGFPGLPGPSGEPGKQGPSGASGERGPPGPMGPPGLAGPPGESG
REGAPGAEGSPGRDGAPGAKGDRGETGPAGPPGAPGAPGAPGPVGPAGKSGDRGETGPAG
PAGPIGPVGARGPAGPQGPRGDKGETGEQGDRGIKGHRGFSGLQGPPGPPVSMLSPSPAP
SPASSLQGPPGSAGTPGKDGLNGLPGPIGPPGPRGRTGDAGPAVSPPTLSAHGPPALKAP
SPRSRYDLSFLPQPPQEKAHDGGRYYRADDANVVRDRDLEVDTTLKSLSQQIENIRSPEG
SRKNPARTCRDLKMCHPDWKSGEYWIDPNQGCNLDAIKVFCNMETGETCVYPTQPSVPQK
NWYISKNPKDKRHVWYGESMTGGFQVREGGQGSDPADVAIQLTFLRLMSTEASQNITYHC
KNSVAYMDQQTGNLKKALLLQGSNEIEIRAEGNSRFTYSVTYDGCTSHTGAWGKTVIEYK
TTKTSRLPIIDVAPLDVGAPDQEFGFDIGSVCFL
E. Molecular weight = 140644 Da
A friend returns from a trip to the Himalayas convinced that she has found evidence of...
Question 3 A 48-year old woman presents to the Psychiatric Clinic where you are working. She has been suffering from memory loss and has lost her way home several times during the past week. During your conversation she explains that she lives alone, and had noticed that she was having problems with smelling food when it had spoiled, so she found herself throwing out her food just because she couldn't remember when she put it in the fridge, and she...
For her research project, Anneka found this great website to predict the transmembrane domains of secretory proteins. An algorithm allows estimating the hydrophobicity of amino acid stretches in the sequence of secretory proteins. Hydrophobic stretches are plotted with positive values on the Y-axis. On the X-axis, Anneka can see the protein sequence expressed as amino acid number, with N-terminus at the intersection with the Y-axis. Example of prediction of TMD domains (a) Human growth hormone receptor (type 1) Nw Signal...
Brooke has just found out that she’s pregnant and is so excited! She’s been dieting most of her life and now she has the opportunity to eat for two! Brooke is also planning ahead and trying to decide if she wants to breastfeed her baby or use formula. Formula seems so much easier, but breastfeeding is less messy and less expensive. Brooke plans on attending a local La Leche League meeting to explore her options. Question 1: Explain to Brook...
Brooke has just found out that she's pregnant and is so excited! She's been dieting most of her life and now she has the opportunity to eat for two! Brooke is also planning ahead and trying to decide if she wants to breastfeed her baby or use formula. Formula seems so much easier, but breastfeeding is less messy and less expensive. Brooke plans on attending a local La Leche League meeting to explore her options. Question 1: Analyze the nutrient...
Frederica wants to try using yogurt as the delivery mechanism for her vaccine. She will clone a gene from S. pneumoniae and express that gene in Lactococcus lactis, an organisms used to make yogurt. Eating the yogurt would serve as the vaccine delivery mechanism. She even has a name for her new vaccine: SpYogurt! Table 4. Potential vaccine candidates for the prevention of S. pneumoniae infections. gene Protein(s) Strain-to-strain sequence variabilitya Protein location Protein activity ID50 of mutantb plyA Pneumolysin...
Mrs. Gardner is 48 years old woman diagnosed with breast cancer. She has been enrolled in a clinical research trial testing the effectiveness of a new chemotherapeutic agent. After her second dose of the agent, she complains of feeling light-headed when she gets out of bed in the morning. Her blood pressure is found to fall from 135/80 to 105/70 when she goes from a supine to a standing position (i.e., orthostatic hypotension). She also complains of frequent urination and...
Prologue: Alice Kaninchenbau was a 20-year-old junior at Boise St. University, where she majored in Political Science and played as an open-side flanker on the women's rugby team. In the last game of the season (against Weber St.) she suffered a broken nose (and the team suffered a 0-36 loss). Always an optimist, Alice considered her broken nose to be the perfect reason to have a rhinoplasty (and get the nose she had always wanted). The case: The antibiotic erythromycin...
Prologue: Alice Kaninchenbau was a 20-year-old junior at Boise St. University, where she majored in Political Science and played as an open-side flanker on the women’s rugby team. In the last game of the season (against Weber St.) she suffered a broken nose (and the team suffered a 0-36 loss). Always an optimist, Alice considered her broken nose to be the perfect reason to have a rhinoplasty (and get the nose she had always wanted). The case: The antibiotic erythromycin...
Part I— Just Bad Luck? Brrrring! Brrrring! Jane checked the caller ID on her phone. “Sam! Great!” she thought. It was always nice to get a call from her older brother. But a little twinge of worry tugged at her. It was just a couple of weeks ago that he had mentioned making an appointment with his doctor about some abdominal pain he had been having. “Hi Sam! It’s great to hear from you,” Jane answered. “Hi Jane. Well I...
The flight attendant had to ask her twice, “Anything to drink, ma’am?” “Oh, sorry. Water, no ice, please,” said Noelle Freeman, the CFO of Franklin Climate Systems. Watching the clouds out her window at 30,000 feet, she’d been deep in thought. She was on her way home from two days in Arkansas visiting her company’s largest facility. Franklin was in the business of designing, engineering, and manufacturing climate control systems for cars and SUVs. This is a division of FB...