Alternative splicing includes the skipping of an exon, retention of an intron or the use of alternative splice donor/acceptor sites (as indicated in chapter 8).
What is the biological function of alternative splicing? (use examples to illustrate your arguments)
Alternate splicing is the process of producing different types of proteins from a single gene sequence (mRNA). It is highly regulated process, it is controlled by different regulatory protiens. In general splicing all the introns are spliced out and exons are ligated, but in alternative splicing it is responsible for diversity in protiens along with removal of introns. Overall function is to increase the diversity in expression of mRNA gene by producing different isoforms of proteins.
For example, in mamalian muscle troponin proteins. Its mRNA contains 5 exon site (1, 2, 3, 4, 5) during alternate splicing one form of troponin protein will contain exon no. 1, 2, 4, 5 and the another protein will have exon no. 1, 2, 3, 5. The change in exon no. cause change in mature mRNA gene sequence which will result in different form of proteins expression.
QUESTION 2 Alternative splicing includes the skipping of an exon, retention of an intron or the use of alternative splice donor/acceptor sites (as indicated in chapter 8 What is the biological function of alternative splicing? (use examples to illustrate your arguments) TTT Arial 3 (12pt) T. . .. 23
why is E the answer Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass transmembrane protein. Shown are the transcriptional start site, splice donor, acceptor and branch sites and translational start and stop codons. Transcriptional start EXON 1 INTRON 1 EXON 2 INTRON 2 EXON 3 Spfice Donor Splice Acceptor Polyadenylation signal Branch point 17. Treatment with ethidium bromide, an intercalating agent, caused DNA polymerase to add an extra...
3of 3 9. The figure below represents the primary transcript of a gene that contains four exons (A, B, C, D) and two introns. The dark block in exon B indicates the position of an additional stop codon; the normal start and stop codons for translation are present in exons A and D respectively. The two arrows indicate alternative 3' splice sites for the first intron Pre-mRNA 5'I 3' intron intron Give a schematic representation of the mature mRNAs that...
A map is shown below for a gene that uses alternative splicing. 5 splice sites are indicated with a 5, while 3 splice sites are indicated with a 3. Boxes below the gene are used to represent the presence of sequence elements found in the pre-mRNA for this gene. Splicing enhancers are shown as filled boxes, while splicing silencers are shown as stippled boxes. The enhancers and silencers only act on the splice site that they overlap (eg., the stippled...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
Genes in eukaryotes are often organized into exons and intrans, which require splicing to produce an mRNA that can be translated. The gene organization is the order of the DNA segments that comprise the gene starting with the promoter, the first exon, the first intron, the second exon, and so on. The interspersed intrans can make gene identification difficult in eukaryotesparticularly in higher eukaryotes with many introns and alternative spliced mRNAs. Prediction of many genes and their organization has been...
QUESTION 6 Assume you are studying a protein-coding gene, ACEX, which includes 4 exons as illustrated in the gene map below. The 5' UTR and 3' UTR segments are each 25 bp long. Exons 1 thru 4 are 100, 200, 300, 400 bp long, respectively. Each intron is 200 bp each. The locations of the relevant EcoRI sites within the ACEX locus are indicated, but the location of other restriction enzyme sites (like BamHI) are not shown." EcoRI probe EcoRI...
(25pts) 2. Suppose the government wants to reduce its budget deficit. Using the long-run model of the economy developed in Chapter 3, illustrate graphically the impact of the alternative fiscal policy measures indicated in parts (a) and (b) below. Be sure to label: (i) the axes, (ii) the curves, (iii) the initial equilibrium values; (iv) the direction curves shift; and (v) the final equilibrium values. (15) a) Suppose the government decides to reduce the government's budget deficit by reducing government...
There are 2 pages in this assignment. There are 3 questions with parts. The weight of each part is indicated in the margin. Please answer the questions carefully. When asked to draw a graph, make sure you label all the curves and the axes. Sloppy work will not be graded or will lose points. Read carefully Chapter 3 as well as your class notes. (30pts) 1. Consider a perfectly competitive economy with K amount of capital and L amount of...
1) Assume the registers are initialized to the indicated values: Se al A c and code frogments MUST use 32 ぁ ar movennes (anor be "nedfra-ne ibrary function or procedural calls ino- Pe Peue c for ll codr ond code frogments only othu ey document your code with Comments unless the code size is Drow Fow Chort for any flow of control involving branches and loops Use PoCedures as modules to organize most of the code and code fragments. In...