Alternative splicing includes the skipping of an exon
Alternative splicing includes the skipping of an exon, retention of an intron or the use of alternative splice donor/acceptor sites (as indicated in chapter 8).
What is the biological function of alternative splicing? (use examples to illustrate your arguments)
Homework Answers
Alternate splicing is the process of producing different types of proteins from a single gene sequence (mRNA). It is highly regulated process, it is controlled by different regulatory protiens. In general splicing all the introns are spliced out and exons are ligated, but in alternative splicing it is responsible for diversity in protiens along with removal of introns. Overall function is to increase the diversity in expression of mRNA gene by producing different isoforms of proteins.
For example, in mamalian muscle troponin proteins. Its mRNA contains 5 exon site (1, 2, 3, 4, 5) during alternate splicing one form of troponin protein will contain exon no. 1, 2, 4, 5 and the another protein will have exon no. 1, 2, 3, 5. The change in exon no. cause change in mature mRNA gene sequence which will result in different form of proteins expression.
QUESTION 2 Alternative splicing includes the skipping of an exon, retention of an intron or the...
QUESTION 2 Alternative splicing includes the skipping of an exon, retention of an intron or the use of alternative splice donor/acceptor sites (as indicated in chapter 8 What is the biological function of alternative splicing? (use examples to illustrate your arguments) TTT Arial 3 (12pt) T. . .. 23
Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass trans...
why is E the answer
Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass transmembrane protein. Shown are the transcriptional start site, splice donor, acceptor and branch sites and translational start and stop codons. Transcriptional start EXON 1 INTRON 1 EXON 2 INTRON 2 EXON 3 Spfice Donor Splice Acceptor Polyadenylation signal Branch point 17. Treatment with ethidium bromide, an intercalating agent, caused DNA polymerase to add an extra...
3of 3 9. The figure below represents the primary transcript of a gene that contains four exons (A, B, C, D) and two introns. The dark block in exon B indicates the position of an additional stop...
3of 3 9. The figure below represents the primary transcript of a gene that contains four exons (A, B, C, D) and two introns. The dark block in exon B indicates the position of an additional stop codon; the normal start and stop codons for translation are present in exons A and D respectively. The two arrows indicate alternative 3' splice sites for the first intron Pre-mRNA 5'I 3' intron intron Give a schematic representation of the mature mRNAs that...
A map is shown below for a gene that uses alternative splicing. 5 splice sites are...
A map is shown below for a gene that uses alternative splicing. 5 splice sites are indicated with a 5, while 3 splice sites are indicated with a 3. Boxes below the gene are used to represent the presence of sequence elements found in the pre-mRNA for this gene. Splicing enhancers are shown as filled boxes, while splicing silencers are shown as stippled boxes. The enhancers and silencers only act on the splice site that they overlap (eg., the stippled...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
Genes in eukaryotes are often organized into exons and intrans, which require splicing to produce an...
Genes in eukaryotes are often organized into exons and intrans, which require splicing to produce an mRNA that can be translated. The gene organization is the order of the DNA segments that comprise the gene starting with the promoter, the first exon, the first intron, the second exon, and so on. The interspersed intrans can make gene identification difficult in eukaryotesparticularly in higher eukaryotes with many introns and alternative spliced mRNAs. Prediction of many genes and their organization has been...
QUESTION 6 Assume you are studying a protein-coding gene, ACEX, which includes 4 exons as illustrated...
QUESTION 6 Assume you are studying a protein-coding gene, ACEX, which includes 4 exons as illustrated in the gene map below. The 5' UTR and 3' UTR segments are each 25 bp long. Exons 1 thru 4 are 100, 200, 300, 400 bp long, respectively. Each intron is 200 bp each. The locations of the relevant EcoRI sites within the ACEX locus are indicated, but the location of other restriction enzyme sites (like BamHI) are not shown." EcoRI probe EcoRI...
(25pts) 2. Suppose the government wants to reduce its budget deficit. Using the long-run model of...
(25pts) 2. Suppose the government wants to reduce its budget deficit. Using the long-run model of the economy developed in Chapter 3, illustrate graphically the impact of the alternative fiscal policy measures indicated in parts (a) and (b) below. Be sure to label: (i) the axes, (ii) the curves, (iii) the initial equilibrium values; (iv) the direction curves shift; and (v) the final equilibrium values. (15) a) Suppose the government decides to reduce the government's budget deficit by reducing government...
There are 2 pages in this assignment. There are 3 questions with parts. The weight of...
There are 2 pages in this assignment. There are 3 questions with parts. The weight of each part is indicated in the margin. Please answer the questions carefully. When asked to draw a graph, make sure you label all the curves and the axes. Sloppy work will not be graded or will lose points. Read carefully Chapter 3 as well as your class notes. (30pts) 1. Consider a perfectly competitive economy with K amount of capital and L amount of...
1) Assume the registers are initialized to the indicated values: Se al A c and code...
1) Assume the registers are initialized to the indicated
values:
Se al A c and code frogments MUST use 32 ぁ ar movennes (anor be "nedfra-ne ibrary function or procedural calls ino- Pe Peue c for ll codr ond code frogments only othu ey document your code with Comments unless the code size is Drow Fow Chort for any flow of control involving branches and loops Use PoCedures as modules to organize most of the code and code fragments. In...
QUESTION 2 Alternative splicing includes the skipping of an exon, retention of an intron or the use of alternative splice donor/acceptor sites (as indicated in chapter 8 What is the biological function of alternative splicing? (use examples to illustrate your arguments) TTT Arial 3 (12pt) T. . .. 23
why is E the answer
Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass transmembrane protein. Shown are the transcriptional start site, splice donor, acceptor and branch sites and translational start and stop codons. Transcriptional start EXON 1 INTRON 1 EXON 2 INTRON 2 EXON 3 Spfice Donor Splice Acceptor Polyadenylation signal Branch point 17. Treatment with ethidium bromide, an intercalating agent, caused DNA polymerase to add an extra...
3of 3 9. The figure below represents the primary transcript of a gene that contains four exons (A, B, C, D) and two introns. The dark block in exon B indicates the position of an additional stop codon; the normal start and stop codons for translation are present in exons A and D respectively. The two arrows indicate alternative 3' splice sites for the first intron Pre-mRNA 5'I 3' intron intron Give a schematic representation of the mature mRNAs that...
A map is shown below for a gene that uses alternative splicing. 5 splice sites are indicated with a 5, while 3 splice sites are indicated with a 3. Boxes below the gene are used to represent the presence of sequence elements found in the pre-mRNA for this gene. Splicing enhancers are shown as filled boxes, while splicing silencers are shown as stippled boxes. The enhancers and silencers only act on the splice site that they overlap (eg., the stippled...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
QUESTION 6 Assume you are studying a protein-coding gene, ACEX, which includes 4 exons as illustrated in the gene map below. The 5' UTR and 3' UTR segments are each 25 bp long. Exons 1 thru 4 are 100, 200, 300, 400 bp long, respectively. Each intron is 200 bp each. The locations of the relevant EcoRI sites within the ACEX locus are indicated, but the location of other restriction enzyme sites (like BamHI) are not shown." EcoRI probe EcoRI...
(25pts) 2. Suppose the government wants to reduce its budget deficit. Using the long-run model of the economy developed in Chapter 3, illustrate graphically the impact of the alternative fiscal policy measures indicated in parts (a) and (b) below. Be sure to label: (i) the axes, (ii) the curves, (iii) the initial equilibrium values; (iv) the direction curves shift; and (v) the final equilibrium values. (15) a) Suppose the government decides to reduce the government's budget deficit by reducing government...
There are 2 pages in this assignment. There are 3 questions with parts. The weight of each part is indicated in the margin. Please answer the questions carefully. When asked to draw a graph, make sure you label all the curves and the axes. Sloppy work will not be graded or will lose points. Read carefully Chapter 3 as well as your class notes. (30pts) 1. Consider a perfectly competitive economy with K amount of capital and L amount of...
1) Assume the registers are initialized to the indicated
values:
Se al A c and code frogments MUST use 32 ぁ ar movennes (anor be "nedfra-ne ibrary function or procedural calls ino- Pe Peue c for ll codr ond code frogments only othu ey document your code with Comments unless the code size is Drow Fow Chort for any flow of control involving branches and loops Use PoCedures as modules to organize most of the code and code fragments. In...
Most questions answered within 3 hours.
-
A manufacturer of chocolate chips would like to know whether its
bag filling machine works correctly...
asked 5 minutes ago -
Consider the student registration business process at
your college:
1.)Describe the steps necessary for you to...
asked 12 minutes ago -
when released from rest at point A, an unknown ion moves to
point B. At point...
asked 4 minutes ago -
A stock is expected to pay the following dividends: $1.1
four years from now, $1.4 five...
asked 9 minutes ago -
G=yellow and g=green pea seeds. You cross a heterozygous
yellow-seeded plant with a green-seeded plant to...
asked 12 minutes ago -
Current Balance Experiment
a) When there is no current flowing through the electromagnet
coil, is there...
asked 11 minutes ago -
In Visual Basic 2017, Write a complete Main method that prints
Hello, world to the screen....
asked 27 minutes ago -
a) Find the pressure difference on an airplane wing if air flows
over the upper surface...
asked 33 minutes ago -
Write an assessment of the current business analysis of Hilton
Worldwide using Porters 5 Forces analysis.
asked 44 minutes ago -
i need help on this
Chapter 9 Section 3 Question 1:
Rudy puts this poster, with...
asked 52 minutes ago -
True or false Assembly x86
41. _____ The program counter is a pointer to the
instruction....
asked 53 minutes ago -
You have conducted an experiment to try to demonstrate that
growth factor receptor X protein (GFRX)...
asked 1 hour ago