What is the major structural difference between glucagon and epinephrine? a. one is a peptide hormone...
What is the major structural difference between glucagon and epinephrine?
a. one is a peptide hormone & one is a small organic molecule
b. one is a charged organic molecule & one is neutral
c. one is negative and one is positive
d. one is amino acid based and one is RNA based
Homework Answers
qAdd Answer to:
What is the major structural difference between glucagon and
epinephrine?
a. one is a peptide hormone...
What is the main difference between the activities of peptide hormones hormones? A. Peptide hormones do...
What is the main difference between the activities of peptide hormones hormones? A. Peptide hormones do not bind to receptors B. Peptide hormones bind to cell surface receptors C. Peptide hormones bind to stretches of RNA D. Steroid hormones bind to intracellular receptors but peptide hormone surface receptors E. Steroid hormones stimulate the release of second messengers but act directly by DNA Hypoglycemia inhibits secretion of which of the following hormones? A. growth hormone B. insulin C. epinephrine D. thyroid...
Choose one of these hormones: Glucagon, Insulin, or Thyroid hormone. What factors will stimulate the release...
Choose one of these hormones: Glucagon, Insulin, or Thyroid hormone. What factors will stimulate the release of this hormone? What are the metabolic effects of this hormone? (Be specific) Is this hormone regulated by a positive or negative feedback mechanism? Explain why.
1. Given the following peptide, which of the following statements is true? Question options: a) The...
1. Given the following peptide, which of the following
statements is true?
Question options:
a) The N-terminal residue is leucine.
b)This peptide contains 4 amino acid residues.
c) The peptide contains a total of 6 ionizable groups.
d) The net charge of this peptide at pH 7 is +1 Locate any
peptide bond along the backbone of the given peptide.
e) The bond between the C (of the C=O) and the N (of the N-H) of
a peptide bond has...
short answer plase 3. What is the role of Conc. H2SO4 in Molisch's reagent test? bond...
short answer plase
3. What is the role of Conc. H2SO4 in Molisch's reagent test? bond in proteins. 4. The positive Biuret test indicates the presence of "Speptible. 5. Why would amino acids give a negative result in the Biuret Test for Proteins? 6. Oxytocin is a hormone; it is a 9-amino acid peptide. Predict the results (+ or -) of the following tests on oxytocin: Biuret test: Ninhydrin test: 7. Describe the structural difference between saturated fatty acids and...
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume...
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume the protein is in solution at physiological pH, and remember to include the amino acids at each end of the chain. A charge may come from the R-group, the N-terminus, and/or the C-terminus. If a residue occurs more than once, include each one in your answer.) List the residues (individual amino acids) that contribute a positive charge: List the residues that contribute a...
what r the correct answers ? The major difference between a mutase and an isomerase enzyme...
what r the correct answers ?
The major difference between a mutase and an isomerase enzyme is Mutase transfers an entire group from one carbon to another, while an isomerase transfers a single atom Mutase causes mutations and isomerase causes isomerization Mutase transfers a single atom from one carbon to another while isomerase transfers entire group Mutase requires ATP while Isomerase does not require any ATP. According to the Chargaff's rule, number of purines = pyrimidines in a given strand...
What is the structural difference between the sugar found in RNA and the sugar found in...
What is the structural difference between the sugar found in RNA and the sugar found in DNA? A. The presence of a 3’ hydroxyl B. The presence of a 2’ hydroxyl C. The presence of a 5’ hydroxyl D. The presence of a ring oxygen
7. Hemoglobin, which carries oxygen to the cell, is an example b. storage of what type...
7. Hemoglobin, which carries oxygen to the cell, is an example b. storage of what type of protein? d. transport c. hormone a. structural 8. An essential amino acid is an amino acid that a. must be provided in the diet. c. does not exist as a zwitterions. b. is missing from the diet d. is synthesized in the body. 9. This amino acid would be: a nonpolar and hydrophobic e. monpolar and hydrophilic b.polar and hydrophobie d. polar and...
MATCHING Terec a adrenal giand E. glucagon g hormone h. insulin k thymus L thyroid gland mthyroxi...
MATCHING Terec a adrenal giand E. glucagon g hormone h. insulin k thymus L thyroid gland mthyroxine n tropic hormone b. aldosterone beta cells d. calcitonin e endocrine gland osytocin For each of these definitions, select the correct matching term from the list above. 1. A hormone produced by the hypothalamus and released by the postesior lobe of che pituitary causes the uterus to contract and stimulates the release of milk from the mammary glands. 2 A hoemone secreted by...
What is one structural difference between Staphylococcus aureus (Gram-positive bacterium) and Escherichia coli (Gram-negative bacterium) that...
What is one structural difference between Staphylococcus aureus (Gram-positive bacterium) and Escherichia coli (Gram-negative bacterium) that would make them have different susceptibilities to antimicrobial agents?
What is the main difference between the activities of peptide hormones hormones? A. Peptide hormones do not bind to receptors B. Peptide hormones bind to cell surface receptors C. Peptide hormones bind to stretches of RNA D. Steroid hormones bind to intracellular receptors but peptide hormone surface receptors E. Steroid hormones stimulate the release of second messengers but act directly by DNA Hypoglycemia inhibits secretion of which of the following hormones? A. growth hormone B. insulin C. epinephrine D. thyroid...
1. Given the following peptide, which of the following
statements is true?
Question options:
a) The N-terminal residue is leucine.
b)This peptide contains 4 amino acid residues.
c) The peptide contains a total of 6 ionizable groups.
d) The net charge of this peptide at pH 7 is +1 Locate any
peptide bond along the backbone of the given peptide.
e) The bond between the C (of the C=O) and the N (of the N-H) of
a peptide bond has...
short answer plase
3. What is the role of Conc. H2SO4 in Molisch's reagent test? bond in proteins. 4. The positive Biuret test indicates the presence of "Speptible. 5. Why would amino acids give a negative result in the Biuret Test for Proteins? 6. Oxytocin is a hormone; it is a 9-amino acid peptide. Predict the results (+ or -) of the following tests on oxytocin: Biuret test: Ninhydrin test: 7. Describe the structural difference between saturated fatty acids and...
what r the correct answers ?
The major difference between a mutase and an isomerase enzyme is Mutase transfers an entire group from one carbon to another, while an isomerase transfers a single atom Mutase causes mutations and isomerase causes isomerization Mutase transfers a single atom from one carbon to another while isomerase transfers entire group Mutase requires ATP while Isomerase does not require any ATP. According to the Chargaff's rule, number of purines = pyrimidines in a given strand...
7. Hemoglobin, which carries oxygen to the cell, is an example b. storage of what type of protein? d. transport c. hormone a. structural 8. An essential amino acid is an amino acid that a. must be provided in the diet. c. does not exist as a zwitterions. b. is missing from the diet d. is synthesized in the body. 9. This amino acid would be: a nonpolar and hydrophobic e. monpolar and hydrophilic b.polar and hydrophobie d. polar and...
MATCHING Terec a adrenal giand E. glucagon g hormone h. insulin k thymus L thyroid gland mthyroxine n tropic hormone b. aldosterone beta cells d. calcitonin e endocrine gland osytocin For each of these definitions, select the correct matching term from the list above. 1. A hormone produced by the hypothalamus and released by the postesior lobe of che pituitary causes the uterus to contract and stimulates the release of milk from the mammary glands. 2 A hoemone secreted by...
Most questions answered within 3 hours.
-
A speeding car is traveling along a straight road with a
constant speed of 100 km/hour....
asked 5 minutes ago -
When 60.1 gg of calcium is reacted with nitrogen gas, 31.7 gg of
calcium nitride is...
asked 10 minutes ago -
The random variable X is exponentially distributed, where X
represents the time it takes for a...
asked 24 minutes ago -
a) Write a verilog module for 1:4 Demultiplexer using verilog
primitives.
b) Design 1-to-4 DEMUX using...
asked 19 minutes ago -
MATLAB
write a MATLAB function (1) output a third-order polynomial
function with the coefficients as the...
asked 32 minutes ago -
A z-score
communicates a raw score’s "relative standing"
under the normal curve in relation to:
asked 41 minutes ago -
An object is vibrating on a spring with the following equation
of motion:
?=(30 ??)cos((2?)/(160)?)
a)...
asked 40 minutes ago -
Vulcan Flyovers offers scenic overflights of Mount St. Helens,
the volcano in Washington State that explosively...
asked 42 minutes ago -
If organizations do not adapt fast enough and move incrementally
from the twentieth-century model to the...
asked 43 minutes ago -
A helium balloon with 2.5L of gas has a gauge pressure of 10,000
Pa. The balloon...
asked 47 minutes ago -
What is responsible for Jupiter's enormous magnetic field?
asked 1 hour ago -
At the end of the year, a company offered to buy 5,000 units of
a product...
asked 1 hour ago