Which one would elute first on GC (gas Chromatography, hexane or toluene? why?
Why does the Toluene elute before Mesitylene on the GC. These are the results of the GC-MS chromatogram. Please help.
Between benzophenone and 4-nitro benzaldehyde which compound is more polar and which compound would elute first in column chromatography, which compound would be higher on a TLC plate and why?
In gas chromatography (GC), why do we use a FAME standard instead of an alkane standard and how can we still use this to calculate a retention index?
Which is more polar and why? - Ferrocene, acetylferrocene or diacetylferrocene Which compound would elute off a column first and which compound would elute off a column last and why?
Which of the following peptides will elute first in size-exclusion chromatography? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2: AWSDEGYIMN Peptide 3: MKLLVTYYICDEEPAQR Peptide 4: FVCCNTTRLEWWQNMSCKLAAPICNMRTTY O Peptide 1 Peptide 2 Peptide 3 Peptide 4
can I have help on question 5 please? Chemistry 70A Experiment 5 - Distillation Fall 2019 5. (4 pts) For gas chromatography, what four factors determine the retention time for organic compounds moving through the column?! 6. (2 pts) Cyclohexane was the first compound to "elute" from the the gc column. Suggest some reasons why cyclohexane elutes before toluene.
Chromatography I Questions Name CHE 201 Date The following solvent systems were found to separate compounds A and B by column chromatography: • A: hexane/ethyl acetate 10:1 • B: hexane/ethyl acetate 10:5 Which is the more polar compound, A or B? Explain your answer for credit, 2) In order to separate a mixture of A and B as in problem (1) by column chromatography: a. Which solvent system must be used first? Why? b. Which compound will elute from the...
Gas Chromatography 1. A sample of a mixture of ethyl acetate (Rt = 1.67 min) and toluene (Rt = 2.65 min) was analyzed by gas chromatography and the following results obtained: Peak # Time [min] Area (uV sec) Area [%] 8.703 1.32 3708 1.67 16449 38.61 52.69 2.65 22449 a. Provide one explanation why three signals were obtained b. What is the normalized percentages of ethyl acetate and toluene.
9 VII. Gas Chromatography 1. The organic mixture to be separated on the GC is injected into the GC as a (gas, liquid, or solid). 2. The typical volume of mixture injected into a GC is 1-10 (microliters, milliliters, or deciliters). 3. Immediately upon entering the injection port the mixture is_ _(solidified, condensed, or vaporized). (heated, cooled, maintained at room 4. The event described in #3 occurs because the injection port is temperature). 5. An inert gas, referred to as...
I am confused with gas chromatography. The question I am being asked is why did we use column B (silicone oil) for separating 1-butene, trans-2-butene, and cis-2-butene from each other in a GC. I have answered all the other questions but I'm completely stuck on this one; can anyone help please?