We need at least 10 more requests to produce the answer.
0 / 10 have requested this problem solution
The more requests, the faster the answer.
Which of the following peptides will elute first in size-exclusion chromatography? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2:...
Are these answers correct? For the following list of peptides, predict which peptide would elute from the column first. Note that all conditions below are based on the fact that the separation is being performed at pH 7. Peptide Name Sequence AGVILPVYATIGSGIVNPAFPVVSLEVVLER GTADVTPDLEEMK QPILIAVVLOLSQQLSGINAVFYYSTSIFEK LMLAVGGAVLGSLQFGYNTGVİ NAPOK VTILELFR Not changed since last attempt Marked out of 2.00 Question 5 Which peptide would elute last from a column that separates ONLY on hydrophobicity? Select one: Not changed since last attempt Marked...
ANSWER ALL 1) Which of the following is the stationary phase in size exclusion chromatography? A. resin B. mixture of proteins C. solvent or buffer D. none of these 2) Suppose you wish to purify a protein that has many positively charged residues from a mixture of proteins. Which of the following columns would elute the protein the fastest? A. column packed with neutral resin B. column packed with positively charged resin C. column packed with negatively charged resin D....
Which of the following peptides will migrate the farthest in SDS-PAGE? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2: AWSDEGYIMN Peptide 3: MKLLVTYYICDEEPAQR Peptide 4: FVCCNTTRLEWWQNMSCKLAAPICNMRTTY Which of the following peptides will migrate the farthest in SDS-PAGE? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2: AWSDEGYIMN Peptide 3: MKLLVTYYICDEEPAQR Peptide 4: FVCCNTTRLEWWQNMSCKLAAPICNMRTTY Peptide 1 Peptide 2 Peptide 3 Peptide 4
Which of the following peptides will migrate the farthest in SDS-PAGE? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2: AWSDEGYIMN Peptide 3: MKLLVTYYICDEEPAQR Peptide 4: FVCCNTTRLEWWQNMSCKLAAPICNMRTTY Peptide 1 Peptide 2 Peptide 3 Peptide 4
Which of these 5 proteins will elute first from the gel filtration (size exclusion) column? Serum albumin (68 kDa) a-lactalbumin (14.2 kDa) O Lactoferrin (87 kDa) k-casein (19 kDa) O b-lactoglobulin (18 kDa) O Glucagon activation of a G protein-coupled membrane receptor (GPCR) induces GTP binding to which of the following membrane anchored proleins? Gbg Phospdlipase A2 None of the mentioned options The GPCR itself Ga Which of the following sphingolipids is a phospholipid? Sphingomyelin Gangliosides None of the mentioned...
Q3. (a) Explain the principle of Size Exclusion Chromatography (SEC). (b) Two polymers of molar mass 21,000 are injected simultaneously in an SEC system. One has Mark-Houwink-Sakurada parameters of K = 2.1 × 10–5 dL.g–1 and α = 0.672, while the other has values of K = 11.4 × 10–5 dL.g–1 and α = 0.716. (i) Will they elute at the same time? If not, which polymer will elute first? (ii) If elution time is proportional to the logarithm of...
Which one would elute first on GC (gas Chromatography, hexane or toluene? why?
16) At which pH values would two different peptides, one with a pl of 5.9 and the other with a pl of 9.1, both bind to a cation exchange column? A) pH 3.9 B) pH 7.3 C) pH 10.9 D) None of the above 17) Which type of gel matrix (aka resin) would separate the following proteins using size exclusion chromatography: protein 1 (2,000 Da), protein 2 (7,000 Da), protein 3 (20,000 Da), and protein 4 (90,000 Da)? A) Gel...
In what order would the proteins elute from a size exclusion column (limit 50- 40,000)? Protein Molecular weight 1- 90 KDa 2- 27,000 KDa 3- 300 KDa
Which HPLC method provides the best estimation of protein concentration: ion exchange chromatography or size exclusion chromatography? Why?