SDS- PAGE stands for Sodium Dodecyl sulphate- Polyacrylamide Gel electrophoresis. SDS acts as a detergent and denatures the protein. It creates negative charge around the peptide. In this way, proteins move across the gel. Smaller proteins faces less hinderance as compared to the larger protein. Peptide 2 is smallest one. That's why it moves to the farthest position in the gel.
Peptide 2 is the answer.
Which of the following peptides will migrate the farthest in SDS-PAGE? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2:...
Which of the following peptides will migrate the farthest in SDS-PAGE? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2: AWSDEGYIMN Peptide 3: MKLLVTYYICDEEPAQR Peptide 4: FVCCNTTRLEWWQNMSCKLAAPICNMRTTY Which of the following peptides will migrate the farthest in SDS-PAGE? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2: AWSDEGYIMN Peptide 3: MKLLVTYYICDEEPAQR Peptide 4: FVCCNTTRLEWWQNMSCKLAAPICNMRTTY Peptide 1 Peptide 2 Peptide 3 Peptide 4
Which of the following peptides will elute first in size-exclusion chromatography? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2: AWSDEGYIMN Peptide 3: MKLLVTYYICDEEPAQR Peptide 4: FVCCNTTRLEWWQNMSCKLAAPICNMRTTY O Peptide 1 Peptide 2 Peptide 3 Peptide 4
In the Western blot experiment, )Why are proteins treated with ionic detergent (SDS), reducing agents (DTT), and heat before SDS-PAGE Why do SDS-coated proteins migrate in an electric field? e molecular mass of myosin light chain I is approximately 22 kD, myosin heavy chain is 200 kD ane actin is 42 kD, Which proteins will migrate fastest through the gel? Why? In the Western blot experiment, )Why are proteins treated with ionic detergent (SDS), reducing agents (DTT), and heat before...
Question 3 (3 points) Which peptide below needs the highest concentration of sodium dodecyl sulfate (SDS) to fully denature? Note: all peptides are the same length. OCCCCCCCC ORRRRRRRR Ossssssss OTTTTTTTT LLLLLLLL GGGGGGGG
a) Which of the two following peptides is most likely to form an amphipathic α-helix? Explain your choice. Peptide #1: SANKSEQLKA or Peptide #2: SLANEAQKLR (b) Which of the two following peptides is most likely to be a β-strand in an amphipathic β-sheet? Explain your choice. Peptide #3: KASNELQLKA or Peptide #4: ELSKNLKAQL 1) (6 pts) (a) which of the two following peptides is most likely to form an amphipathic α-helix? Explain your choice. Peptide #1: SANKSEQLKA or Peptide #2:...
SDS-PAGE with and without DDT suggests that a protein contains two peptides linked by a disulfied bond. How would you process the protein so that it can be sequenced by Edman degradation method?
1. Figure I shows an SDS-PAGE gel. A) Rank the 3 proteins by size, from largest to smallest. Explain why this trend is observed in SDS-PAGE gels. B) What is the purpose of SDS in SDS-PAGE? C) Sample L is the ladder. What is its purpose? D) Typically, PA (polyacrylamide) is used as the gel for protein electrophoresis, whereas agarose is used for DNA electrophoresis. Explain why a different gel material is used, Specifically referring to the pore size of...
Why are MHC molecules able to bind a variety of peptides? 1. the peptide-binding groove of a specific MHC molecule can bind several peptides simultaneously 2. The MHC genes undergo somatic recombination to produce thousands of MHC molecule variants 3. MHC bind very loosely and transiently to peptide antigens, so a wide variety of peptide antigens can bind any specific MHC molecule 4. a small number of amino acids in the peptide antigen bind specifically to complementary pockets in the...
please help Tor F. A) High molecular weight proteins will migrate farther during gel electrophoresis (SDS-PAGE). d) B-sheet protein structures can be stabilized by hydrogen bonding between distant residues on the same polypeptide. e) B-sheets are a type of secondary structure and are found in every protein.
Are these answers correct? For the following list of peptides, predict which peptide would elute from the column first. Note that all conditions below are based on the fact that the separation is being performed at pH 7. Peptide Name Sequence AGVILPVYATIGSGIVNPAFPVVSLEVVLER GTADVTPDLEEMK QPILIAVVLOLSQQLSGINAVFYYSTSIFEK LMLAVGGAVLGSLQFGYNTGVİ NAPOK VTILELFR Not changed since last attempt Marked out of 2.00 Question 5 Which peptide would elute last from a column that separates ONLY on hydrophobicity? Select one: Not changed since last attempt Marked...