Homework Answers
5.) A
Sequence A has more hydrophobic amino acids as compared to other sequence, so on the basis of hydrophobicity , this sequence would be the last to elute out.
6.) B
Anion exchange chromatography , means matrix is anion exchanger ( has + charge) , and it binds to anion.
Sequence B would be the last to elute because it has more amino acids which has negatively charged side chains.
7.) E, this is correctly marked.
Add Answer to:
Are these answers correct?
For the following list of peptides, predict which peptide would elute...
Which of the following peptides will elute first in size-exclusion chromatography? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2:...
Which of the following peptides will elute first in size-exclusion chromatography? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2: AWSDEGYIMN Peptide 3: MKLLVTYYICDEEPAQR Peptide 4: FVCCNTTRLEWWQNMSCKLAAPICNMRTTY O Peptide 1 Peptide 2 Peptide 3 Peptide 4
Use answers from answer bank and place in the correct bins. Peptides can be separated using...
Use answers from answer bank and place in the correct bins.
Peptides can be separated using an ion-exchange column based on their isoelectric (pl) values. At which pH values would two different peptides, one with a pl of 5.0 and the other with a pl of 9.2, bind to a cation- and anion-exchange column? Each peptide may be capable of binding to each column at more than one pH value. anion-exchange column at pH = 3.0 cation-exchange column at pH...
16) At which pH values would two different peptides, one with a pl of 5.9 and...
16) At which pH values would two different peptides, one with a pl of 5.9 and the other with a pl of 9.1, both bind to a cation exchange column? A) pH 3.9 B) pH 7.3 C) pH 10.9 D) None of the above 17) Which type of gel matrix (aka resin) would separate the following proteins using size exclusion chromatography: protein 1 (2,000 Da), protein 2 (7,000 Da), protein 3 (20,000 Da), and protein 4 (90,000 Da)? A) Gel...
Pls help answer questions 1-5!! Which of these hormones could be taken orally? (multiple answers allowed)...
Pls help answer questions 1-5!!
Which of these hormones could be taken orally? (multiple answers allowed) Question 4 Not yet answered Marked out of 1.00 Select one or more: a. Estrogen b. Insulin Flag question c. T3/T4 O d. Biogenic amines Question 5 Which of the following would require a carrier protein to be soluble in the blood? Not yet answered Marked out of 1.00 Flag question Select one or more: O a. proteins/peptides O b. biogenic amines O c....
Question 1 Not changed since last attempt Marked out of 2.00 P Flag question Following IFRS,...
Question 1 Not changed since last attempt Marked out of 2.00 P Flag question Following IFRS, significant influence investments are usually called: Select one: O A. Investments in financial instruments O B. Long-term equity method investments O C. Noncurrent stock investments D. Investments in associates
Question 2 Not changed since last attempt Marked out of 2.00 P Flag question What is...
Question 2 Not changed since last attempt Marked out of 2.00 P Flag question What is "value-in-use," as used in reporting intercorporate investments, per IFRS? Select one: O A. Market value of the investment in an active market O B. Present value of the investment's future expected cash flows 0 C. Market value of the investment when acquired o D. Present value of the investment's future dividend payments
DOBA101 Finish attempt ... Print Question 6 Not changed since last attempt Marked out of 2.00...
DOBA101 Finish attempt ... Print Question 6 Not changed since last attempt Marked out of 2.00 P Hag question Rand Corporation acquires Southern Company's assets and liabilities for $20,000,000 in cash. At the date of acquisition, Southern's balance sheet reported assets of $75,000,000 and liabilities of $65,000,000. Investigation reveals that Southern's reported plant assets are overvalued by $1,400,000. Rand reports how much goodwill on this acquisition? Select one: A $8,600,000 O B. $11,400,000 O C. $7,000,000 O D, $10,000,000
Biochem help 2 14. What would be the net charge on the dipeptide Ser-His at pH-...
Biochem help 2
14. What would be the net charge on the dipeptide Ser-His at pH- 6.04? (Choose the one best answer.) a) 1.5 b) +1; c) +0.5 d) 0 e) -0.5; 15. The pKa of a lysine side chain in a protein ending up on the outside of a globular protein has a different pKa than if the lysine is buried within the interior of a protein. What would be the expected pKa of a side chain of lysine...
Question 4 Not changed since last attempt Marked out of 2.00 P Flag question Grant Corporation...
Question 4 Not changed since last attempt Marked out of 2.00 P Flag question Grant Corporation has owned 40% of the voting stock of Halliday Company for many years, originally purchased current year, the carrying value of the investment is $2,000,000. Halliday reports a loss of $6,000,000 for the yea What amount should Grant report as equity in the net loss of Halliday for the current year? Select one: o A. $2,000,000 O B. $2,400,000 O O C. none D....
Question 25 Which of the following is the correct formula for the profit margin ratio? Not...
Question 25 Which of the following is the correct formula for the profit margin ratio? Not yet answered Marked out of 2.00 Select one: O A. Net profit * Capital invested O B. Net profit/ Sales P Flag question C. Net sales / Average total assets OD. Operating income / Net sales Question 26 Costs that do not differ between alternatives are Not yet answered Marked out of 2.00 P Flag question Select one: O A. important only if they...
Which of the following peptides will elute first in size-exclusion chromatography? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2: AWSDEGYIMN Peptide 3: MKLLVTYYICDEEPAQR Peptide 4: FVCCNTTRLEWWQNMSCKLAAPICNMRTTY O Peptide 1 Peptide 2 Peptide 3 Peptide 4
Use answers from answer bank and place in the correct bins.
Peptides can be separated using an ion-exchange column based on their isoelectric (pl) values. At which pH values would two different peptides, one with a pl of 5.0 and the other with a pl of 9.2, bind to a cation- and anion-exchange column? Each peptide may be capable of binding to each column at more than one pH value. anion-exchange column at pH = 3.0 cation-exchange column at pH...
16) At which pH values would two different peptides, one with a pl of 5.9 and the other with a pl of 9.1, both bind to a cation exchange column? A) pH 3.9 B) pH 7.3 C) pH 10.9 D) None of the above 17) Which type of gel matrix (aka resin) would separate the following proteins using size exclusion chromatography: protein 1 (2,000 Da), protein 2 (7,000 Da), protein 3 (20,000 Da), and protein 4 (90,000 Da)? A) Gel...
Pls help answer questions 1-5!!
Which of these hormones could be taken orally? (multiple answers allowed) Question 4 Not yet answered Marked out of 1.00 Select one or more: a. Estrogen b. Insulin Flag question c. T3/T4 O d. Biogenic amines Question 5 Which of the following would require a carrier protein to be soluble in the blood? Not yet answered Marked out of 1.00 Flag question Select one or more: O a. proteins/peptides O b. biogenic amines O c....
Question 1 Not changed since last attempt Marked out of 2.00 P Flag question Following IFRS, significant influence investments are usually called: Select one: O A. Investments in financial instruments O B. Long-term equity method investments O C. Noncurrent stock investments D. Investments in associates
Question 2 Not changed since last attempt Marked out of 2.00 P Flag question What is "value-in-use," as used in reporting intercorporate investments, per IFRS? Select one: O A. Market value of the investment in an active market O B. Present value of the investment's future expected cash flows 0 C. Market value of the investment when acquired o D. Present value of the investment's future dividend payments
DOBA101 Finish attempt ... Print Question 6 Not changed since last attempt Marked out of 2.00 P Hag question Rand Corporation acquires Southern Company's assets and liabilities for $20,000,000 in cash. At the date of acquisition, Southern's balance sheet reported assets of $75,000,000 and liabilities of $65,000,000. Investigation reveals that Southern's reported plant assets are overvalued by $1,400,000. Rand reports how much goodwill on this acquisition? Select one: A $8,600,000 O B. $11,400,000 O C. $7,000,000 O D, $10,000,000
Biochem help 2
14. What would be the net charge on the dipeptide Ser-His at pH- 6.04? (Choose the one best answer.) a) 1.5 b) +1; c) +0.5 d) 0 e) -0.5; 15. The pKa of a lysine side chain in a protein ending up on the outside of a globular protein has a different pKa than if the lysine is buried within the interior of a protein. What would be the expected pKa of a side chain of lysine...
Question 4 Not changed since last attempt Marked out of 2.00 P Flag question Grant Corporation has owned 40% of the voting stock of Halliday Company for many years, originally purchased current year, the carrying value of the investment is $2,000,000. Halliday reports a loss of $6,000,000 for the yea What amount should Grant report as equity in the net loss of Halliday for the current year? Select one: o A. $2,000,000 O B. $2,400,000 O O C. none D....
Question 25 Which of the following is the correct formula for the profit margin ratio? Not yet answered Marked out of 2.00 Select one: O A. Net profit * Capital invested O B. Net profit/ Sales P Flag question C. Net sales / Average total assets OD. Operating income / Net sales Question 26 Costs that do not differ between alternatives are Not yet answered Marked out of 2.00 P Flag question Select one: O A. important only if they...
Most questions answered within 3 hours.
-
Suppose that Alicia has $30,000 in invested as follows: $10,000
in TJX Cos., $15,000 in Macy’s,...
asked 5 minutes ago -
Volunteer Pharmaceuticals (VP) wants to set aside money in the
R&D fund to seek supplemental drug...
asked 6 minutes ago -
What is precedent?
an order by the court.
the power of a court to overrule a...
asked 12 minutes ago -
Classify the tonicity of a solution made by dissolving 12mg of
sodium chloride in 1.0mL of...
asked 18 minutes ago -
Consider the equilibrium reaction: 2A (aq) + 3B (aq) <-->
C (aq) (in my notation <-->...
asked 19 minutes ago -
A recent poll found that 21% of a random sample of 1200 people
lost jobs due...
asked 25 minutes ago -
Indicate whether aqueous solutions of the following substances
contain ions. If so, write formulas for the...
asked 21 minutes ago -
Include at least one psychology theory, model or concept
discussed in Chapter 1, 2 or the...
asked 30 minutes ago -
Need help in drawing out a map pathway of pentose phosphate
pathway and pyruvate dehydrogenase/citric acid...
asked 38 minutes ago -
Question 1
At the end of Year 6,
South Co.'s tax department estimates that they will...
asked 39 minutes ago -
Use standard enthalpies of formation to determine
ΔHorxn for:
1. 3NO2(g) + H2O(l) → 2HNO3(aq)
+...
asked 44 minutes ago -
Abigail Adams was hired as an associate professor of economics
at Heartland University. She was the...
asked 46 minutes ago