Question

1. Give four specific counter examples for why each of the following definitions for a gene...

1. Give four specific counter examples for why each of the following definitions for a gene are incorrect.  For each definition, there may be several possible counter examples.  For full credit, each counter example should be distinct.  For example, if a friend of yours claimed that “a gene is all the DNA sequences that determine an inherited trait”, you could reply: “No, that is incorrect, because multiple genes will often determine an inherited trait.”

A. “A gene is a sequence of nucleotides from a start codon to a stop codon.”

B. “A gene is a sequence of nucleotides that codes for a functional protein.”

C. “A gene is a sequence of nucleotides that codes for an RNA molecule (which may be translated).”

D. “A gene is the entire DNA sequence that affects the production of a protein.”

0 0
Add a comment Improve this question Transcribed image text
Answer #1

A. Genes do not only include the region of nucleotides between the start and stop codons, but genes also includes regions before the start codon (5' untranslated region) and regions after the stop codon (3' untranslated region).

B. Genes do not only code for proteins, they also code for tRNA and rRNA molecules, which are never translated or converted into proteins.

C. Some genes are silenced in a genome, they are paternally or maternally imprinted and are never transcribed into RNA.

D. There are promoters, enhancers and silencer regions on DNA that affect the production of proteins. These regions are not considered as 'genes'.

Add a comment
Know the answer?
Add Answer to:
1. Give four specific counter examples for why each of the following definitions for a gene...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • 1. this proteins is responsible for increasing or decreasing supercoiling of DNA A. Helicase B. DNA...

    1. this proteins is responsible for increasing or decreasing supercoiling of DNA A. Helicase B. DNA Polymerase C. Topoisomerase D. RNA Polymerase E. DNA ligase 2. a gene is best defined as A. A segment of DNA that contains inherited information that defines the structure of a protein or RNA B. thee nucleotides that code for an amino acid C. a translated unit of DNA D. a sequence of nucleotides in RNA that codes for a functional product 3. This...

  • ANSWER THE FOLLOWING QUESTIONS 1) What is the relationship between a gene and a protein? 2)...

    ANSWER THE FOLLOWING QUESTIONS 1) What is the relationship between a gene and a protein? 2) How does the tRNA contribute to protein synthesis? 3) The ability of cell to control their gene expression is called 4) What is a promoter? 5) What process convert the message from mRNA into amino acids? 6) The following expressions are true or false? Explain a. "A gene is any DNA sequence that is transcribed to any type of RNA b. "In eukaryotes, a...

  • The individual subunits making up each strand of DNA are called1 Inherited traits are determined by...

    The individual subunits making up each strand of DNA are called1 Inherited traits are determined by elements of heredity called__2 . 3 __ in the base sequence to a DNA Transcription is a production of an RNA strand that is_ strand. In eukaryotes RNA_ 4 synthesizes mRNA, located in the The main concept in the 6 of molecular biology is that DNA does not code for protein directly but rather acts through an intermediary molecule of ribonucleic acid (RNA). An...

  • Background Information How can we predict where a coding gene will be in bacteria? And can...

    Background Information How can we predict where a coding gene will be in bacteria? And can we then predict what protein will be produced? Take the DNA sequence below, for example. tcaggctttaattcatccgtgatctttgacgacggtaaatacgatgcagatataatacgatgaccgatgccaatcgaccgatcaaggaggcaccgaatggcgatgatggcgatgattgcgattaacgaagtggaacgcattatggcgggcattaacgaagatacccatgcgaccggcgaaaacgaaaccatttgcagctgcgcgaactttgaagaactgacccatgcgaccggccgcgaagcgacctaaaagtcgtaattacgtatcaagtcatgggccgcgggcgcccggcccactgactagactagggccgggcgcccgcggcccaccatataaataaaaaaaaaaaaaacgaggctatagctcatcaatgacct If you were a bacterial RNA polymerase, what sequence(s) should there be in this DNA for you to bind and begin transcribing? And if you found such sequence(s), where would you begin transcription? As a human being looking at this fragment of DNA, what type of consensus sequence(s)...

  • Gene structure Complete the following paragraph to describe the structure of a gene. Answer choices may...

    Gene structure Complete the following paragraph to describe the structure of a gene. Answer choices may be used more than once or not at all. protein or RNA Pieces of DNA that contain information that produce a product are called genes. protein Each of the roughly genes within the human body are responsible for some aspect of its biology, from the color of hair to the structure and function of the liver. 38,000 19,000 Some genes may contain information for...

  • onaformation from a ee is used in the synthesisof 17 functional gene product. A) Geno B)...

    onaformation from a ee is used in the synthesisof 17 functional gene product. A) Geno B) Gene regulation C) Epigenetics D) Imprinting E) Chromatin remodeling 18. A histone code is the: A) B) nucleotide sequence of an individual histone protein's gene. pattern of chemical modification of the DNA wrapped around an individual histone. C) D) E) pattern of chemical modification of the histone tails. number of amino acids in an individual histone that are methylated None of the other answer...

  • The individual subunits making up each strand of DNA are called__1 Inherited traits are determined by...

    The individual subunits making up each strand of DNA are called__1 Inherited traits are determined by elements of heredity called__2_ 3__ in the base sequence to a DNA Transcription is a production of an RNA strand that is__ strand. In eukaryotes RNA 4 synthesizes mRNA, located in the The main concept in the 6 of molecular biology is that DNA does not code for protein directly but rather acts through an intermediary molecule of ribonucleic acid (RNA). An individual having...

  • DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2...

    DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2 Gene 1 Gene 3 DNA strand3 TRANSLATION Protein Trp Gly Model 2 ACTIVITY and QUESTIONS 1. Based on the information you can gather from model 1 complete the following sentences: a. The nucleotide Adenine (A) always pairs with the nucleotide b. The nucleotide Guanine (G) always pairs with the...

  • Genetics Worksheet Week 3: Gene Regulation and Epigenetics 1. Duchenne muscular dystrophy is caused by a mutation in a gene that is 2.5 million nucleotides in length and encodes a protein called dyst...

    Genetics Worksheet Week 3: Gene Regulation and Epigenetics 1. Duchenne muscular dystrophy is caused by a mutation in a gene that is 2.5 million nucleotides in length and encodes a protein called dystrophin. The dystrophin protein itself is 3684 amino acids in length. Calculate below the approximate size of the mRNA that encodes dystrophin. Approximately what percentage of the gene that encodes dystrophin is intron sequence? The human genome encodes a much greater variety and number of proteins than the...

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT
ADVERTISEMENT