1. A pentapeptide with antimicrobial properties is isolated from an annelid. Sequencing of this peptide revealed...
1. A pentapeptide with antimicrobial properties is isolated from an annelid. Sequencing of this peptide revealed the amino acid sequence: GYARC .
- What is the net charge of the peptide at the following pH values? Explain your answers using the chemical structure of the peptide.
- pH= 2 b) pH 7.5 c) pH 10.5
Homework Answers
Add Answer to:
1. A pentapeptide with antimicrobial properties is isolated from
an annelid. Sequencing of this peptide revealed...
c) You place your pentapeptide into a buffer with a pH=4. What direction will your pentapeptide...
c) You place your pentapeptide into a buffer with a pH=4. What direction will your pentapeptide move: Circle the correct answer. (2 marks) It will not move. Towards the positive electrode Towards the negative electrode Briefly Explain why: (2 marks) d) You are trying to separate 2 other peptides from your pentapeptide. Peptide 1 is made up of the amino acids: ARKS Peptide 2 is made up of the amino acids: ADES At what pH would you be able to...
What is the approximate net charge of the following pentapeptide at pH 10? Arg-Gln-Cys-His-Ala What is...
What is the approximate net charge of the following pentapeptide at pH 10? Arg-Gln-Cys-His-Ala What is the Isoelectric point (pI) of the peptide given above? Use the pKa values given here when needed: Side group/ amino acid pKa Asp 3.9 Glu 4.1 HIs 6.0 Cys 8.4 Tyr 10.5 Lys 10.5 Arg 12.5 C-term 3.5 N-term 9.0
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume...
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume the protein is in solution at physiological pH, and remember to include the amino acids at each end of the chain. A charge may come from the R-group, the N-terminus, and/or the C-terminus. If a residue occurs more than once, include each one in your answer.) List the residues (individual amino acids) that contribute a positive charge: List the residues that contribute a...
The isoelectric point (pI) of a peptide is the pH at which the peptide does not...
The isoelectric point (pI) of a peptide is the pH at which the
peptide does not migrate in an electric field. Since the peptide is
zwitterionic, there are the same number of positive charges as
negative charges on the peptide population. The pI can be estimated
fairly accurately (within 0.1 or 0.2 pH units) from the pK values
of all the proton dissociable groups in the peptide. Using pK
values from the table at the right, estimate the pI value...
The isoelectric point (pI) of a peptide is the pH at which the peptide does not...
The isoelectric point (pI) of a peptide is the pH at which the
peptide does not migrate in an electric field. Since the peptide is
zwitterionic, there are the same number of positive charges as
negative charges on the peptide population. The pI can be estimated
fairly accurately (within 0.1 or 0.2 pH units) from the pK values
of all the proton dissociable groups in the peptide. Using pK
values from the table at the right, estimate the pI value...
#1) For the following pentapeptide (Where pH =1): a) What would the net charge be for...
#1) For the following pentapeptide (Where pH =1):
a) What would the net charge be for the following pH?
pH 0 =
pH 3 =
pH 5 =
pH 7 =
pH 10 =
pH 13 =
b) Calculate the pl of the pentapeptide. (Cysteine: pK1 = 1.96,
pK2 = 10.128) ( Glutamine: pK1 = 2.17 , pK2 = 9.13) (Arginine: pK1
= 2.17. pK2 = 9.04) (Leucine: pK1 = 2.36 , pK2 = 9.60)
c) If you were to...
The isoelectric point (pI) of a peptide is the pH at which the peptide does not...
The isoelectric point (pI) of a peptide is the pH at which the peptide does not migrate in an electric field. Since the peptide is zwitterionic, there are the same number of positive charges as negative charges on the peptide population. The pI can be estimated fairly accurately (within 0.1 or 0.2 pH units) from the pK values of all the proton dissociable groups in the peptide. Using pK values from the table at the right, estimate the pI value...
please answer thoroughly and correctly thjs js my last try Vasopressin is a peptide hormone synthesized...
please answer thoroughly and correctly thjs js my last try
Vasopressin is a peptide hormone synthesized by the hypothalamus; in its reduced form it has the structure shown. NH2 HS H H₂N н NH2 SH H NH2 OH Vasopressin NH *H N NH2 This structure is incorrect in that one of the amino acids is shown in the D-configuration, rather than the L. Which one is it? What is the amino acid sequence of this peptide? CYFONCPRG Enter your answer...
Using the following peptide, answer the following questions: HWESPGHAKCNKL. A.) This peptide has the following pKa...
Using the following peptide, answer the following questions: HWESPGHAKCNKL. A.) This peptide has the following pKa values associated with it: 2.1, 4.3, 6.0, 8.1, 9.3 & 10.7. What is the pI for this peptide? B.) What would be the overall charge on this peptide at: (i) pH 12? (ii) pH 7? C.) If this protein has the following modifications: one K side chain which is acetylated and the S side chain is phosphorylated. What would be the approximate pI for...
Proteins (For these questions, you may research online or from the prescribed text book to arrive...
Proteins (For these questions, you may research online or from the prescribed text book to arrive at your answers), for each question, justify your answers through technical reasoning. (5 points each) I. What is the general structure of an α-amino acid? Give an overview of general properties of amino acids. Comment on the particular characteristics of some amino acids and explain what the reason for their particular behavior is. 2. Write the chemical formula of a peptide that consists of...
c) You place your pentapeptide into a buffer with a pH=4. What direction will your pentapeptide move: Circle the correct answer. (2 marks) It will not move. Towards the positive electrode Towards the negative electrode Briefly Explain why: (2 marks) d) You are trying to separate 2 other peptides from your pentapeptide. Peptide 1 is made up of the amino acids: ARKS Peptide 2 is made up of the amino acids: ADES At what pH would you be able to...
The isoelectric point (pI) of a peptide is the pH at which the
peptide does not migrate in an electric field. Since the peptide is
zwitterionic, there are the same number of positive charges as
negative charges on the peptide population. The pI can be estimated
fairly accurately (within 0.1 or 0.2 pH units) from the pK values
of all the proton dissociable groups in the peptide. Using pK
values from the table at the right, estimate the pI value...
The isoelectric point (pI) of a peptide is the pH at which the
peptide does not migrate in an electric field. Since the peptide is
zwitterionic, there are the same number of positive charges as
negative charges on the peptide population. The pI can be estimated
fairly accurately (within 0.1 or 0.2 pH units) from the pK values
of all the proton dissociable groups in the peptide. Using pK
values from the table at the right, estimate the pI value...
#1) For the following pentapeptide (Where pH =1):
a) What would the net charge be for the following pH?
pH 0 =
pH 3 =
pH 5 =
pH 7 =
pH 10 =
pH 13 =
b) Calculate the pl of the pentapeptide. (Cysteine: pK1 = 1.96,
pK2 = 10.128) ( Glutamine: pK1 = 2.17 , pK2 = 9.13) (Arginine: pK1
= 2.17. pK2 = 9.04) (Leucine: pK1 = 2.36 , pK2 = 9.60)
c) If you were to...
please answer thoroughly and correctly thjs js my last try
Vasopressin is a peptide hormone synthesized by the hypothalamus; in its reduced form it has the structure shown. NH2 HS H H₂N н NH2 SH H NH2 OH Vasopressin NH *H N NH2 This structure is incorrect in that one of the amino acids is shown in the D-configuration, rather than the L. Which one is it? What is the amino acid sequence of this peptide? CYFONCPRG Enter your answer...
Proteins (For these questions, you may research online or from the prescribed text book to arrive at your answers), for each question, justify your answers through technical reasoning. (5 points each) I. What is the general structure of an α-amino acid? Give an overview of general properties of amino acids. Comment on the particular characteristics of some amino acids and explain what the reason for their particular behavior is. 2. Write the chemical formula of a peptide that consists of...
Most questions answered within 3 hours.
-
When light is refracted, on what does the angle of refraction
depend? Select all that apply....
asked 17 minutes ago -
1. Choose the answer that is closest to the definition of a
significance level
a) If...
asked 1 minute ago -
A (726) g mass is hung on a spring. As a result the spring
stretches (16.5)...
asked 1 hour ago -
SOLUTION NOT NEEDED ONLY NEED THE ANSWERS, HOMEWORK IS DUE IN 30
MINUTES.
4)Which of the...
asked 1 hour ago -
You will select one card from a standard deck of 52 cards. What
is the probability...
asked 2 hours ago -
50% of the volume of a boat, sailing down the Mississippi (where
the water density ρ...
asked 2 hours ago -
Calculate how many moles of ions are in 1.4 L of 2.9 M KNO2
(aq). Remember...
asked 3 hours ago -
Experiment:
In the experiment: Mix together 74 g. (92 ml.) of n-butyl
alcohol and 120 g....
asked 3 hours ago -
This Python module will be menu driven
and use conditions to check user input in order...
asked 4 hours ago -
Tip Calculator App
For this project, you will create a tip calculator Android
app. The user...
asked 4 hours ago -
A first order chemical reaction has an energy of activation of
90.0 kJ/mol and a rate...
asked 6 hours ago -
Which statement is not correct?
Mutations change the sequence of nucleotides in DNA.
Mutations can be...
asked 8 hours ago