An example of an operational taxonomic unit (OTU) is a. Multiple sequence alignment. b. Protein sequence....
An example of an operational taxonomic unit (OTU) is
a. Multiple sequence alignment.
b. Protein sequence.
c. Clade.
d. Node.
Homework Answers
a. Multiple sequence alignment is an example of operational taxonomic unit (OTU).
Add Answer to:
An example of an operational taxonomic unit
(OTU) is
a. Multiple sequence alignment.
b. Protein sequence....
C. A 2 1. Figure A Figure B When three operational units (OTUS) A, B and...
C. A 2 1. Figure A Figure B When three operational units (OTUS) A, B and Care concerned, one can make one bifurcating unrooted tree with one node, 1, as shown in figure A. If one more OTU, D, is added to the tree in figure A, one can attach D to any of the three edges (A1, B1, C1), thus one can make three topologically unique unrooted trees with one new node, node 2, as shown In figure B....
1. Which types of methods are generally used for Tertiary Structure Prediction? a. Sequence Alignment and...
1. Which types of methods are generally used for Tertiary Structure Prediction? a. Sequence Alignment and Template Matching b. Sequence Homology and Threading c. Modeling and Database Search d. Multiple Sequence Alignment and Similarity Search
Biochemistry What is the protein domain in the context of a sequence alignment algorithm? How do you identify domain sin...
Biochemistry What is the protein domain in the context of a sequence alignment algorithm? How do you identify domain sin PFam?
The following are descriptions regarding the progressive approach for multiple sequence alignment used in Clustal algorithm....
The following are descriptions regarding the progressive approach for multiple sequence alignment used in Clustal algorithm. Put the statements in the correct order, such that they are in the right order in the Clustal algorithm. A- The already aligned sequences are converted into a consensus sequence. A pair wise alignment is conduct for very possible pair of sequences using the Needleman Wunsch algorithm A distance matrix is generated. A guide tree is created using the information in the distance matrix....
2. Complete these Practice Questions: 2A. Which of the three trees below depicts a different pattern...
2. Complete these Practice Questions: 2A. Which of the three trees below depicts a different pattern of relationships than the others? G F A B GB DE CAF C E D G F AB 2B. By reference to the tree below, which of the following is an accurate statement of relationships? Amoeba Red Alga Green Alga Moss Pine ACTIVITY SECTION 9 SPRING 2020 a. A green alga is more closely related to a red alga than to a moss. b....
Protein sequence A: MGPLVPRGSMALIVLGGVAGLLLFIGLGIFFSVRSRHRRRQAERMSQIKRLLSEKKTSQSPHRFQKTHSPI DNA sequence B: ATGGGCCCGCTGGTGCCGCGCGGCAGCATGGCGCTGATT GTGCTGGGCGGCGTGGCGGGCCTGCTGCTGTTTATTGGC CTGGGCATTTTTTTTAGCGTGCGCAGCCGCCATCGCCGC CGCCAGGCGGAACGCATGAGCCAGATT
Protein sequence A: MGPLVPRGSMALIVLGGVAGLLLFIGLGIFFSVRSRHRRRQAERMSQIKRLLSEKKTSQSPHRFQKTHSPI DNA sequence B: ATGGGCCCGCTGGTGCCGCGCGGCAGCATGGCGCTGATT GTGCTGGGCGGCGTGGCGGGCCTGCTGCTGTTTATTGGC CTGGGCATTTTTTTTAGCGTGCGCAGCCGCCATCGCCGC CGCCAGGCGGAACGCATGAGCCAGATTAAACGCCTGCTG AGCGAAAAAAAAACCAGCCAGAGCCCGCATCGCTTTCAG AAAACCCATAGCCCGATT Primer Sequence C: 5’ CTGCTGCTGTTTATTGGC 3’ The first 20 amino acids in ‘Protein sequence A’ form a transmembrane helix. The remainder of the protein forms a globular cytoplasmic domain. (i) Without copying out any sequence, describe the product you would expect to generate from a PCR reaction using ‘Primer sequence C’ as the forward primer, ‘DNA sequence B’ as the template and a reverse primer that matches...
Aristotle's taxonomic classification indicated a sequence of biologically simple to more complex organisms, usually called the...
Aristotle's taxonomic classification indicated a sequence of biologically simple to more complex organisms, usually called the "Great Chain of Beings". This was used in Medieval times to support the notion that evolution was not taking place, and that there was "stasis" (or no change). a. True b. False c. Non applicable at this context Select one: O A. A O B.B O c.
An operational database: Multiple Choice a. is updated before transactions are processed. b. contains data that...
An operational database: Multiple Choice a. is updated before transactions are processed. b. contains data that are volatile. c. covers the data of current and previous fiscal years. d. contains data that are uploaded from a data warehouse.
47. A) Which of the following substances is an example of a globular protein? Insulin B)...
47. A) Which of the following substances is an example of a globular protein? Insulin B) Myoglobin C) Hemoglobin D) All these are globular 48. Which of the following represents the structure of glycerol? CHO CH OH н-с-он HO CHI CEO CHO А сн,он H- -OH CHOH B. CHOK c. CHOH CH2OH снон D. CHOH 49. The following is not a global protein A) Myoglobin B) Albumin ins C) Insulin 50. All the followings are proteins except by: A) lipase...
A specific stretch of DNA that programs the amino acid sequence of a protein is a...
A specific stretch of DNA that programs the amino acid sequence of a protein is a A. nucleic acid B. protein C. gene D. enzyme
C. A 2 1. Figure A Figure B When three operational units (OTUS) A, B and Care concerned, one can make one bifurcating unrooted tree with one node, 1, as shown in figure A. If one more OTU, D, is added to the tree in figure A, one can attach D to any of the three edges (A1, B1, C1), thus one can make three topologically unique unrooted trees with one new node, node 2, as shown In figure B....
The following are descriptions regarding the progressive approach for multiple sequence alignment used in Clustal algorithm. Put the statements in the correct order, such that they are in the right order in the Clustal algorithm. A- The already aligned sequences are converted into a consensus sequence. A pair wise alignment is conduct for very possible pair of sequences using the Needleman Wunsch algorithm A distance matrix is generated. A guide tree is created using the information in the distance matrix....
2. Complete these Practice Questions: 2A. Which of the three trees below depicts a different pattern of relationships than the others? G F A B GB DE CAF C E D G F AB 2B. By reference to the tree below, which of the following is an accurate statement of relationships? Amoeba Red Alga Green Alga Moss Pine ACTIVITY SECTION 9 SPRING 2020 a. A green alga is more closely related to a red alga than to a moss. b....
Aristotle's taxonomic classification indicated a sequence of biologically simple to more complex organisms, usually called the "Great Chain of Beings". This was used in Medieval times to support the notion that evolution was not taking place, and that there was "stasis" (or no change). a. True b. False c. Non applicable at this context Select one: O A. A O B.B O c.
47. A) Which of the following substances is an example of a globular protein? Insulin B) Myoglobin C) Hemoglobin D) All these are globular 48. Which of the following represents the structure of glycerol? CHO CH OH н-с-он HO CHI CEO CHO А сн,он H- -OH CHOH B. CHOK c. CHOH CH2OH снон D. CHOH 49. The following is not a global protein A) Myoglobin B) Albumin ins C) Insulin 50. All the followings are proteins except by: A) lipase...
Most questions answered within 3 hours.
-
How many ways can 2 people be chosen and arranged in a straight
line if there...
asked 44 minutes ago -
(Problem 1d). Leandro has 16 hours per day that he can allocate
to work or leisure....
asked 1 hour ago -
Morganton Company
makes one product and it provided the following information to help
prepare the master...
asked 1 hour ago -
2Al + 3Cl2 --> 2AlCl3
If one mole Al is reacted w two moles Cl2, how...
asked 2 hours ago -
1. You will see some trends in the movement of each currency vs.
the US Dollar....
asked 2 hours ago -
9. (9 pts) An investor with a stock portfolio worth several
hundred thousand dollars sued his...
asked 3 hours ago -
Which statement is true?
a. Unless directed otherwise, the computer automatically
executes C. statements one before...
asked 3 hours ago -
When a new company is considering Speed to Market for a product
launch, which would provide...
asked 4 hours ago -
bacteria and their metabolites could either promote or protect from
cancer. Explain one of these cases...
asked 4 hours ago -
Use the sample data and confidence level given below to complete
parts (a) through (d).
A...
asked 4 hours ago -
During laser vision correction, a brief burst of 193 nm
ultraviolet light is projected onto the...
asked 4 hours ago -
1 ) How well does the initial speed, v0,calculated from Equation
4 agree with the value...
asked 4 hours ago