•What force, and between what atoms, maintains the shape of the helix?
•what is the term for the process by which the peptide bonds in proteins are broken by the addition of water?
• what is the name of the bond formed between 2 amino acids in a protein?
•draw the tetrapeptide gly- cys- phe- aka showing all atoms with correct bonds between them and charges where appropriate.
•What force, and between what atoms, maintains the shape of the helix? •what is the term...
11.Which of the following mutations would most likely to disrupt the structure of an α-helix? Cys to Ala Lys to Arg Glu to Gly Val to Leu 12.Which amino acid combination is the most preferred to occupy positions 1 and 4 in an α-helix? Glu and Lys Phe and Pro Lys and Arg Asp and Glu 13.If each turn in the standard alpha helix extends 5.4 A and there are 3.6 amino acid residues per turn, how many amino acids...
25) What maintains the secondary structure of a protein? a) hydrophobic interactions b) hydrogen bonds between the R groups c) peptide bonds d) disulfide bonds e) hydrogen bonds between the amino group of one peptide bond and the carboxyl group of another peptide bond
Proteins contain the same 3 atoms as carbohydrates, and fat and those 3 atoms are? What does protein contain that carbohydrate and fat do not? Amino means? Proteins are synthesized from building blocks called? There are 20 amino acids in the body; nine are classified as: What is the difference between essential and nonessential amino acids? What is the name of the bond that unites one amino acids to one another? Discuss the difference between hydrolysis and condensation Digestion and...
What fragments will be obtained by a trypsin hydrolysis of the following octapeptide? Ala-Val-Trp-Lys-Phe-Gly-Arg-Met A) Ala-Val-Trp-Lys-Phe and Gly-Arg-Met 3) Ala-Val-Trp-Lys-Phe-Gly and Arg-Met - Ala-Val-Trp-Lys and Phe-Gly-Arg and Met ) Ala-Val-Trp-Lys and Phe and Gly-Arg and Met ) Ala-Val-Trp and Lys-Phe-Gly and Arg-Met Bradykinin is a nonapeptide, Arg-Pro-Pro-Gly-Phe-Ser-Pro-Phe-Arg. In addition to one mole of Arg, what peptides are present after hydrolysis of bradykinin with chymotrypsin? A) Arg-Pro-Pro and Gly-Phe and Ser-Pro-Phe B) Pro-Pro-Gly and Phe-Ser-Pro-Phe-Arg C) Arg-Pro-Pro-Gly-Phe and Ser-Pro-Phe ?) Arg-Pro-Pro-Gly-Phe-Ser...
Question 5 (1 point) Saved What arrow correctly identifies a peptide bond? LED H2N -CH-CJN-CH-C-R-CHCN-CH-8 CH-OH - CH₂ CH3 Question 4 (1 point) Identify all the amino acids that can be produced using the three letter designation (Use your textbook). HN-CH-C-N-CH-C-N-CH-C-N-CH-C CH-OH CH, 0 0 Al...Gly...-Cys...-Ser Gly.-.-Ala----Glu ---Met Glu----Ala----Thr----Cys Ala-Gly-Thr-Tyr 0 0 Question 3 (1 point) Use the three letter designation for the amino acids to write the tetrapeptide order: HN-CH-C-N-CH-C-N-CH-C-N-CH-C 525-5 Ala...Gly...Cys-..-Ser Gly....Ala---- Glu---- Met Glu---- Ala...-Thr-Cys OCys...-Ala----Gly-Ser Question...
Refer to the figure below. BC 0 CH-C-NCHONCH THEO "CH-C-N-CH-C-00 CH & - E - E - F - 8 CH CHE Asp NH Phe C Lys NH Arg Which of the following is broken during hydrolysis reactions that release the molecule's monomers as products? a. Bond A b. Bond B woled stalla on c. Bond C d. Bond D e. Bond E se 28. An amino acid can be classified by the a. number of amino groups it contains....
1 attempts left Check my work Choose the key term that matches the description provided: High molar mass biomolecules that regulate the use of genetic information to regulate the synthesis of proteins. Transfer RNA Deoxyribonucleic acid Nucleic acids Active site Ribonucleotide Lipid Secondary structure Translation O Peptide Carbohydrate Choose the key term that matches the description provided: The secondary structure adopted by many proteins, in which the protein chain is twisted into a helix Protein Pleated sheet structure Codon Hydrolysis...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
Protein Structure A protein contains a string of amino acids (usually more than 50) that has a biological function. 15ecause proteins are so large, their structure has several levels, all of which are important for the proper functioning of the protein. Ultimately, the sequence of amino acids (ordering of polar and nonpolar amino acids) dictates the 3-dimensional shape of a protein and this dictates its primary function. Level 1: Primary (1") The amino acid sequence of a polypeptide Protein Backbone...
please explain each question thoroughly. thanks Question 3: Arg-Cys-Met-Ala-Cys-Gly-Arg-Pro-Asn-Tyr-Leu-Trp-Ala-Ile-His-Phe-Ser-Cys-Lys a. What would happen if this peptide were to be incubated with dinitrofluorobenzene (FDNB) followed by 6M HCl hydrolysis at 1100C for 24 hrs. What labeled product(s) would be detected? Consider the following pepide: What would happen if the peptide were treated with CNBr? What would the products be? Why? b. What would happen if the peptide were treated with chymotrypsin? What would the c. products be? Why? Arg-Cys-Met-Ala-Cys-Gly-Arg-Pro-Asn-Tyr, Leu-Trp, Ala-Ile-His-Phe,...