1)what is the locus of (genomic and chromosomal coordinates) of the dystrophin gene? 2)What is the...
1)what is the locus of (genomic and chromosomal coordinates) of the dystrophin gene?
2)What is the size (exact number of nt or bp) of the dystrophin gene?
3)What percentage of the dystrophin gene is protein coding?
Homework Answers
ANSWER:
Dystrophin gene is known as DMD is a Protein Coding gene. Diseases associated with DMD include Muscular Dystrophy, Duchenne Type and Muscular Dystrophy, Becker Type.
1) Locus of Dystrophin gene= Xp21
2) Size of Dystrophin gene (the largest known human gene) =23X105 bp ( 2.3mb) (0.08% of the human genome)
3) Dystrophin gene contains 79 exons that are linked together to form the instructions for making dystrophin protein.
(rate if answer is helpful)
Add Answer to:
1)what is the locus of (genomic and chromosomal
coordinates) of the dystrophin gene?
2)What is the...
1. Create the primers to amplify the gene of interest. 1. Below is almost the full...
1. Create the primers to amplify the gene of interest. 1. Below is almost the full sequence of the coding strand of the F9 gene (exon 2-exon4) that you found in the online database (NCBI, Genomic sequence F9 gene). Some of the sequence is missing, but you know how many nucleotides are skipped. Design forward and reverse primers 18nt each for PCR that will isolate EXACTLY the sequence that is in bold typeface. Exon 2 = 164 nt Intron 2...
1) Where are deletions most likely to occur in this dystrrophin gene? 2) Explain why elevated...
1) Where are deletions most likely to occur in this dystrrophin gene? 2) Explain why elevated blood creatine kinase levels are a good proteomic marker for Duchenne muscular dystrophy. 3) Why is it more difficult to screen females for variants in the dystrophin gene? 4)In a muscle cell, where is the dystrophin protein located?
Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass trans...
why is E the answer
Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass transmembrane protein. Shown are the transcriptional start site, splice donor, acceptor and branch sites and translational start and stop codons. Transcriptional start EXON 1 INTRON 1 EXON 2 INTRON 2 EXON 3 Spfice Donor Splice Acceptor Polyadenylation signal Branch point 17. Treatment with ethidium bromide, an intercalating agent, caused DNA polymerase to add an extra...
Genetics Worksheet Week 3: Gene Regulation and Epigenetics 1. Duchenne muscular dystrophy is caused by a mutation in a gene that is 2.5 million nucleotides in length and encodes a protein called dyst...
Genetics Worksheet Week 3: Gene Regulation and Epigenetics 1. Duchenne muscular dystrophy is caused by a mutation in a gene that is 2.5 million nucleotides in length and encodes a protein called dystrophin. The dystrophin protein itself is 3684 amino acids in length. Calculate below the approximate size of the mRNA that encodes dystrophin. Approximately what percentage of the gene that encodes dystrophin is intron sequence? The human genome encodes a much greater variety and number of proteins than the...
1) Suppose that gene A 3,000 bp. Suppose that g contained within intron 1 opposite directions...
1) Suppose that gene A 3,000 bp. Suppose that g contained within intron 1 opposite directions for the two genes. covers 10,000 base pairs (bp) and has 2 exons; the intron in gene A is ene B covers 1,500 bp and has two exons. Gene B is completely of gene A. The direction of the transcriptional bubble moves in A. Draw the genomic organization (i.e., exons and introns) of gene A AND gene B. Label the polarity of the DNA...
1) Explain why immunohistochemical staining for dystrophin protein is patchy in a female carrier? 2)Develop a...
1) Explain why immunohistochemical staining for dystrophin protein is patchy in a female carrier? 2)Develop a flowchart for diagnosis of muscular dystrophy (including distinction between the two major types – 2 pts) 3) What is the standard of care for patients with Duchenne muscular dystrophy?
Question 1) With which definition of Gene do you agree most? Provide reasoning. . 1910- Gene...
Question 1) With which definition of Gene do you agree most? Provide reasoning. . 1910- Gene as a distinct Locus . 1940 - Gene as a blueprint for a protein . 1950- Gene as a physical molecule • 1960- Gene as a transcribed code • 1970-80 - Gene as an open reading frame (ORF) . 1990-2000 - Gene as an annotated genomic entity in databases Question2) Details BEDNA/GC CA korhoz nowwhat shou DOWS190 Gene models FS206. 3 2 F5006.3 (par...
QUESTION 6 Assume you are studying a protein-coding gene, ACEX, which includes 4 exons as illustrated...
QUESTION 6 Assume you are studying a protein-coding gene, ACEX, which includes 4 exons as illustrated in the gene map below. The 5' UTR and 3' UTR segments are each 25 bp long. Exons 1 thru 4 are 100, 200, 300, 400 bp long, respectively. Each intron is 200 bp each. The locations of the relevant EcoRI sites within the ACEX locus are indicated, but the location of other restriction enzyme sites (like BamHI) are not shown." EcoRI probe EcoRI...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
1. Create the primers to amplify the gene of interest. 1. Below is almost the full sequence of the coding strand of the F9 gene (exon 2-exon4) that you found in the online database (NCBI, Genomic sequence F9 gene). Some of the sequence is missing, but you know how many nucleotides are skipped. Design forward and reverse primers 18nt each for PCR that will isolate EXACTLY the sequence that is in bold typeface. Exon 2 = 164 nt Intron 2...
why is E the answer
Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass transmembrane protein. Shown are the transcriptional start site, splice donor, acceptor and branch sites and translational start and stop codons. Transcriptional start EXON 1 INTRON 1 EXON 2 INTRON 2 EXON 3 Spfice Donor Splice Acceptor Polyadenylation signal Branch point 17. Treatment with ethidium bromide, an intercalating agent, caused DNA polymerase to add an extra...
Genetics Worksheet Week 3: Gene Regulation and Epigenetics 1. Duchenne muscular dystrophy is caused by a mutation in a gene that is 2.5 million nucleotides in length and encodes a protein called dystrophin. The dystrophin protein itself is 3684 amino acids in length. Calculate below the approximate size of the mRNA that encodes dystrophin. Approximately what percentage of the gene that encodes dystrophin is intron sequence? The human genome encodes a much greater variety and number of proteins than the...
1) Suppose that gene A 3,000 bp. Suppose that g contained within intron 1 opposite directions for the two genes. covers 10,000 base pairs (bp) and has 2 exons; the intron in gene A is ene B covers 1,500 bp and has two exons. Gene B is completely of gene A. The direction of the transcriptional bubble moves in A. Draw the genomic organization (i.e., exons and introns) of gene A AND gene B. Label the polarity of the DNA...
Question 1) With which definition of Gene do you agree most? Provide reasoning. . 1910- Gene as a distinct Locus . 1940 - Gene as a blueprint for a protein . 1950- Gene as a physical molecule • 1960- Gene as a transcribed code • 1970-80 - Gene as an open reading frame (ORF) . 1990-2000 - Gene as an annotated genomic entity in databases Question2) Details BEDNA/GC CA korhoz nowwhat shou DOWS190 Gene models FS206. 3 2 F5006.3 (par...
QUESTION 6 Assume you are studying a protein-coding gene, ACEX, which includes 4 exons as illustrated in the gene map below. The 5' UTR and 3' UTR segments are each 25 bp long. Exons 1 thru 4 are 100, 200, 300, 400 bp long, respectively. Each intron is 200 bp each. The locations of the relevant EcoRI sites within the ACEX locus are indicated, but the location of other restriction enzyme sites (like BamHI) are not shown." EcoRI probe EcoRI...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
Most questions answered within 3 hours.
-
Researchers measured the data speeds for a particular smartphone
carrier at 50 airports. The highest speed...
asked 8 minutes ago -
Ingraham Inc. currently has $880,000 in accounts receivable, and
its days sales outstanding (DSO) is 47...
asked 9 minutes ago -
Look at sample problem 19.6 in the 8th ed Silberberg book.
Enter your answers in scientific...
asked 29 minutes ago -
A long straight wire carries a current of 5.00 A at a distance r from the...
asked 30 minutes ago -
A 125
g baseball is thrown at a speed of 127ft/sec at a batter, the ball...
asked 35 minutes ago -
If you have an eta squared of .34 and used a
between-subjects design, what does that...
asked 43 minutes ago -
*Healthcare Adminstration*
Scutchfield and Keck's Principles of Public Health Practice
4th edition
What are the differences...
asked 47 minutes ago -
Find the complete optimal solution to this linear programming
problem. Max 5x + 3y s.t. 2x...
asked 1 hour ago -
The pH of an acetate buffer was determined to be 4.76. Then, a
few drops of...
asked 1 hour ago -
a sample of size 1500 is used to find a confidence
interval for the percentage of...
asked 1 hour ago -
Explain in detail the differences between qualitative and
quantitative forecasts. Include at least two examples of...
asked 1 hour ago -
Differentiate between response time and throughput.
Explain how the physical design of a database influences
performance...
asked 1 hour ago