ZuoTi.Pro
Question

(True or False) Fragile X syndrome is thought to be caused by the inactivation of a...

(True or False) Fragile X syndrome is thought to be caused by the inactivation of a gene spanning the fragile region on the X chromosome due to a large number of trinucleotide repeats just upstream from the coding sequence of the gene.

science   biology   
0 0
Add a comment Improve this question Transcribed image text
Next > < Previous
Sort answers by oldest

Homework Answers

Answer #1

The statement is true.

Explanation: Fragile X syndrome is resulted due to the inactivation of FMR1 gene which is located on the long (q) arm of chromosome X (FRAXA site). When CGG trinucleotide repeats in the 5' untranslated region of FMR1 present in excess number (More than 200 repeats), it resulted in the inactivation of the gene. Thus, the statement is true.

0 0
Add a comment
Know the answer?
Add Answer to:
(True or False) Fragile X syndrome is thought to be caused by the inactivation of a...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Log In

Sign Up

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions

  • Fragile X syndrome, Huntington disease and Friedrich Ataxia are all examples of trinucleotide expansion disorders. a.Explain...

    Fragile X syndrome, Huntington disease and Friedrich Ataxia are all examples of trinucleotide expansion disorders. a.Explain why it takes over 200 trinucleotide repeats in Fragile X gene before a patient shows symptoms, while individuals with Huntington disease display full penetrance only after 40 trinucleotide repeats in the huntingtin gene. b. Present an explanation of why such high repeat numbers are possible in Friedreich Ataxia. c. Trinucleotide repeat examples in human disease are far more numerous than tetranucleotide repeats. Give two...

  • 19) Trisomy 21, or Down syndrome, occurs when there is a nom complement but one (extra)...

    19) Trisomy 21, or Down syndrome, occurs when there is a nom complement but one (extra) chromosome 21. Although fertility is reduced in both sexes, females have higher fertility rates than males. Van Dyke et al. (1995; Down Syndrome Research and Practice 3(2):65-69) summarize data involving children born of Down syndrome individuals. Assume that children are born to a female with Down syndrome and a normal 46-chromosome male. What proportion of the offspring would be expected to have Down syndrome?...

  • Marfan Syndrome, one of the most common inherited disorders of connective tissue, is caused by an...

    Marfan Syndrome, one of the most common inherited disorders of connective tissue, is caused by an autosomal dominant mutation within the fibrillin-1 gene (FBN1) on the short arm of chromosome 15. Pooled ten-year records from several large hospitals in the United States revealed that, among 5,000,000 live births (=10,000,000 gametes), the total number of babies born with Marfan Syndrome was 250. Among those 250 babies, 187 of them had at least one parent with Marfan Syndrome, and the remaining babies...

  • AIDS (acquired immunodeficiency syndrome), caused by the HIV virus is very common in Zaire. The virus...

    AIDS (acquired immunodeficiency syndrome), caused by the HIV virus is very common in Zaire. The virus infects T cells of individuals by binding to a protein on the surface of T cells, named CCR5. Scientists observed that some people in Zaire never developed AIDS, even when they were exposed to the virus. They thought this could be due to the fact that CCR5 gene has two alleles in the Zairean population (CCR5-S (S); sensitive to AIDS; and CCR-R (R): resistant...

  • genetic biology 5'-GCATGAGTCTGGTACGCTTTTAAAGC-3' 3-CATGCG-5' IIIII 3. (a) in the sequence above, what enzyme would you need...

    genetic biology 5'-GCATGAGTCTGGTACGCTTTTAAAGC-3' 3-CATGCG-5' IIIII 3. (a) in the sequence above, what enzyme would you need to extend the short stretch of nucleotides shown on the bottom strand? (b) Write the sequence of the newly synthesized fragment and label its S' and 3' end. (c) The covalent bond between these adjacent nucleotides is what type of chemical bond? After using a chemical mutagen to generate mutations in a DNA sequence, scientists noted a mutation from C to T at the...

  • Which of the following is TRUE of incomplete penetrance? Select one: a. Epistatic interactions can result...

    Which of the following is TRUE of incomplete penetrance? Select one: a. Epistatic interactions can result in incomplete penetrance in some cases. b. Environmental factors do not influence penetrance. c. Incomplete penetrance implies that some individuals will experience less severe forms of disease, such as cancer or Alzheimer's. d. Incomplete penetrance is never observed with Huntington's disease e. Incomplete penetrance refers to cases in which individuals developing a particular disease (e.g., cancer or Alzheimer's) lack the typical genotype for this...

  • TRUE OR FALSE 1. Claudins are the proteins associated with the establishment of the paracellular barrier...

    TRUE OR FALSE 1. Claudins are the proteins associated with the establishment of the paracellular barrier between cells. The charged amino acids of the extracellular loop are thought to form ion-selective pores that allow the passage of specific ions through the barrier. By changing the charged amino acids to nonpolar ones, a hydrophobic region is created that excludes polar molecules (including ions) while allowing the passage of nonpolar substances. This would obviously affect the function of the tissue in which...

  • ON MULTIPLE CHOICE, CIRCLE LETTER OF ALL CORRECT ANSWERS!!! 31. (2 pts) True or False. Sexual...

    ON MULTIPLE CHOICE, CIRCLE LETTER OF ALL CORRECT ANSWERS!!! 31. (2 pts) True or False. Sexual dimorphism is the phenomenon that caused biologists to focus on sexual selection. 32. ( pts) What is the most important basic underlying difference between the sexes that causes sexual selection to usually operate differently in males than in females? A. The cost of reproduction is usually higher in females. B. The cost of reproduction is usually higher in males. C. Males have only 1...

  • QUESTION 1 MC. Which of the following disease conditions might NOT be treatable by RNAI? a....

    QUESTION 1 MC. Which of the following disease conditions might NOT be treatable by RNAI? a. arthritis b. Cancer caused by tumor suppressor gene mutation c. macular degeneration d. cancer caused by oncogen mutation S 5 QUESTION 2 MC. What is the molecular cause of male courtship behavior in fruit flies? a. Alternative splicing of the fruitless transcript b. RNA editing of the fruitless transcript C. Alternative sequence of the fruitless DNA d. Alternative 3' cleavage and polyadenylation of fruitless...

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT
ADVERTISEMENT