ZuoTi.Pro
Question

Which of the following statements about splicing is false? A. a single gene can code for...

Which of the following statements about splicing is false?

A. a single gene can code for many types of protein due to alternative splicing

B. The 5' and 3' regions of the intron are highly variable in sequence

C. the spliceosome is found in the nucleus of the cell

D. The mRNA is composed of exons; introns are spliced out

science   biology   
0 0
Add a comment Improve this question Transcribed image text
Next > < Previous
Sort answers by oldest

Homework Answers

Answer #1

Option B is the correct answer.

The statement that, "the 5' and 3' regions of the intron are highly variable in sequence" is false with respect to splicing. The typical eukaryotic nuclear intron has consensus sequences defining important regions. Each intron has GU at its 5' end. Near the 3' end there is a branch site. The nucleotide at the branchpoint is always an A; the consensus around this sequence varies somewhat.

The other statements are true, sincle alternative splicing is the reason that complex organisms like humans are able to code for such a large number of proteins. Spliceosome is found in nucleus as that is the site of splicing. Introns are intervening sequences in mRNA which are spliced out, leaving behind exons.

0 0
Add a comment
Know the answer?
Add Answer to:
Which of the following statements about splicing is false? A. a single gene can code for...
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Log In

Sign Up

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions

  • QUESTION 1 Which of the following statements regarding splicing is FALSE?        A) The length...

    QUESTION 1 Which of the following statements regarding splicing is FALSE?        A) The length of introns determines the efficiency of splicing. B) Many human neurological disorders are caused by splicing errors and/or mutations in splicing factors.        C) Splicing requires the action of a variety of snRNAs that direct the transesterification reactions.        D) Splicing is dictated by sequence features in pre-mRNA transcripts QUESTION 2 Which of the following mRNA processing factors does NOT associate with...

  • 5. A eukaryotic protein-encoding gene contains two introns and three exons: exon 1–intron 1–exon 2–intron 2–exon...

    5. A eukaryotic protein-encoding gene contains two introns and three exons: exon 1–intron 1–exon 2–intron 2–exon 3. The 5ʹ splice site at the boundary between exon 2 and intron 2 has been eliminated by a small deletion in the gene. Describe how the pre-mRNA encoded by this mutant gene would be spliced. Indicate which introns and exons would be found in the mRNA after splicing occurs

  • Which of the following is NOT a feature of RNA processing in eukaryotes? a. Caps and...

    Which of the following is NOT a feature of RNA processing in eukaryotes? a. Caps and tails are added to RNA transcripts before they leave the nucleus b. Multiple genes are represented in one mRNA from an operon c. Introns are removed and exons are spliced back together to make mature mRNA d . "Alternative splicing" means that one gene in the genome can encode multiple products e. The sequence that codes for one eukaryotic gene is not a continuous...

  • Question 3 Which of the following statements about RNA splicing is false? Small RNA molecules in...

    Question 3 Which of the following statements about RNA splicing is false? Small RNA molecules in the nucleus participate in the splicing reactions necessary for the removal of introns. Splicing occurs after the cap has been added to the end of the mRNA Formation of the lariat intermediate is dependent on the 3' OH. Splicing can remove coding as well as non-coding sequence.

  • Genes in eukaryotes are often organized into exons and intrans, which require splicing to produce an...

    Genes in eukaryotes are often organized into exons and intrans, which require splicing to produce an mRNA that can be translated. The gene organization is the order of the DNA segments that comprise the gene starting with the promoter, the first exon, the first intron, the second exon, and so on. The interspersed intrans can make gene identification difficult in eukaryotesparticularly in higher eukaryotes with many introns and alternative spliced mRNAs. Prediction of many genes and their organization has been...

  • 11. A gene is best defined as a. A segment of DNA b. Three nucleotides that...

    11. A gene is best defined as a. A segment of DNA b. Three nucleotides that code for an amino acid. C. A sequence of nucleotides in DNA that codes for a functional product. d. A sequence of nucleotides in RNA that codes for a functional product. e. A transcribed unit of DNA. 12. Which of the following statements is false? a. DNA polymerase joins nucleotides in one direction only. b. The leading strand of DNA is made continuously c....

  • Can someone please help with these two questions? Thank you. 4. Here is an RNA transcript...

    Can someone please help with these two questions? Thank you. 4. Here is an RNA transcript freshly transcribed from a gene. It is immature, meaning that it has not been processed yet into a mature mRNA. a) If you could zoom in on this molecule, what two things would you observe at the molecular level that would indicate to you that it is RNA and not DNA? b) Which end of the molecule was the last bit to be transcribed,...

  • TTA Assignment 5 Finals Review oints) For splicing, introns are identified by the spliceosome by the...

    TTA Assignment 5 Finals Review oints) For splicing, introns are identified by the spliceosome by the following sequences: on the 5 side of the on: AAGT on the 3' end of the intron: CAGG. In the following DNA sequence, identify the splice sites, introns and ACAGG NA: A A GCG TAATTACTTACAGGTGGACATATCGTTATAGGCGT-3 TATTAATGAATGTACACGAGTATAGCAATATCCGCT-5' 'CAATGGAT What is the protein sequence once the mRNA is spliced (Use the codon chart on the last page? a. sequence bee as mutated to CTG G A...

  • Which of the following statements is/are false/incorrect. Select all that apply. You may select multiple options....

    Which of the following statements is/are false/incorrect. Select all that apply. You may select multiple options. CAMP levels are negatively correlated with glucose levels E. coli preferentially uses arabinose over glucose Laco (operator) can act in trans Lacl (repressor) can act in trans CAMP binding to CRP facilitates transcription of many operons O Alternative splicing can generate multiple transcripts from the same gene Introns are spliced out of bacterial mRNA before translation Enhancers work in only one orientation and when...

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT
ADVERTISEMENT