12) Answer
No, we cannot predict the nucleotide sequence of an mRNA from amino
acid sequence of its polypeptide product.
Genetic code is degenerate which means multiple codons can be used
for one amino acid.
The DNA to amino acids coding is redundant which means that some
amino acids coded by multiple codons. Codons are sets of 3
nucleotides.
But if we know the sequence of a gene then we predict the amino
acid of a protein
Example:
Amino acid serine can be coded for by a UCA, UCC, UCU, or UCG.
These codons are different only in last nucleotide. Thus, here we
notice that these are minor mutations in DNA. If we consider UCA,
and A mutated into G. Then we see it will code for serine only.
This is called as silent mutation as it does not affect the protein
production.
To find Arg there are 6 different codons that can be used. But we
do not know what is sequence on gene. There are multiple
possibilities (6 possibilities).
Eukaryotic mRNA is modified during and after transcription. Which end of the mRNA is shown on this page and what is the common name for this structure? What is the name of this base (see arrow) a...
Which type of transcriptional termination requires formation of a stem loop secondary structure in the RNA? What is the primary factor involved in the termination of RNA synthesis? Is a new nucleotide added to a growing strand of RNA at the 3′ end? DNA and associated histones compose what molecule? Be able to use a codon table to give the sequence of amino acids from an mRNA sequence. I will give you an mRNA sequence; you will indicate how many...
1 pts DI Question 6 What region of this molecule shown would bind to mRNA during translation? 3' A-OH 5' A Cacceptor stem G C G- U TuC loop D-loop C U GACAC m'A GGAGAGm m' G C-G A-U variable loop Anticodon loop Cm U A Gm A A The 5' end The anticodon loop The 3 end The variable loop The acceptor stem D Question 7 1 pts What is synthesized during transcription? O a strand of tRNA O...
please explain
Mailings Review View ferences av A. A AaBbCcDdEe 211 av AalbCcDdte AaBbCcD AaBbCcDdE AaB No Spacing Heading 1 Heading 2 Title Normal 1a. Given your understanding of transcription and translation, fill in the blanks below for each nucleotide and polypeptide sequence. Assume that translation requires a start codon, and that there is no processing of the pre-mRNA before translation. Non-template strand of DNA: 5' CAGTATGT ATGACAAT GCA 3' Template strand of DNA: 3" GTCAT A CATAC TGTTA CGT...
21-1114 Date Transcription Kit Checklist Part 1: Making mRNA 1. Parts of a nucleotide: Approved Sugar Phosphate Bases: Adenine Guanine Cytosine Uracil 2. One nucleotide Note: Omit 3-6 if not using the DNA Structure and Function Kit. 3. Separated DNA 4. Template DNA with one complementary nucleotide of RNA hydrogen bonded 5. Template DNA with strand of mRNA hydrogen bonded 6. Separated mRNA and duplex DNA molecule 7. Completed mRNA with cap and tail 8. The cap 9. The tail...
hello, two of these circled answers are incorrect.
1 6. The promoter sequences are the positions that: signal the initiation site of a gene (+1) B) bind the transcriptional factor that is associated with RNA polymerase e) attach the correct nucleotide triphosphate to the template DNA strand D) separate the two DNA strands CUA 7. A particular triplet of bases in the coding sequence of DNA is GAT. The anticodon on the tRNA that binds the mRNA codon is A...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
What are the three functional groups that comprise a nucleotide? What do nucleotides have in common with amino acids or simple sugars? When the structure of DNA was first elucidated, many biologists quickly saw how this structure explained the passage of information from one generation to another. How does the structure of DNA explain generation-to-generation flow of information? In other words, give a brief description of the structure of DNA and tell how this structure allows for replication. Which of...
5. Which of the followin g is After the DNA unwinds only one strand acts as a compliance The two strands only act as a plate when paired In prokaryotes the binding of RNAP the two strands After the DNA unwind hath DNA strands at templates occurs randomly on either of of RNA polymerase to unwound DNA Occurs 14. What is an anticodon? The three RNA behaal with nifie umino acid. The three RNA bases that air with a c...
29. Which of the following would be synthesized in and processed by the smooth endoplasmic reticulum and Golgi apparatus? A. lipids and steroids B. DNA polymerase and RNA polymerase C. lysosomal enzymes D. cytoskeletal proteins 30. Which of the following are processed in the Golgi apparatus? A. integral membrane proteins of the plasma membrane B. proteins that are secreted from the cell C. proteins that will be broken down by lysosomes D. all of the above E. none of the...