The answer is C but why?Homework Answers
Three stop codons, UAG, UAA, and UGA code for non-sense mutations..
The normal gene sequence is : UU_ CU_ CC_ AC_ GU_ AC_AC_CG_UGG
Mutant 3 sequence is :- UU_ CU_ CC_ AC_ GU_ AC_AC_CG_UAG
There is a transition mutation in either the second or the third nucleotide of UGG (Trp) which converts it into stop codon.
Add Answer to:
The answer is C but why?
15. Below is the middle region of a particular polypeptide....
The answer is C but why? 15. Below is the middle region of a particular polypeptide....
The answer is C but why?
15. Below is the middle region of a particular polypeptide. The wild-type amino acid sequence and the sequence of several mutant polypeptides are given ( ... indicates additional, unspecified amino acids). Which of the five mutant polypeptides is most likely to be the result of a nonsense mutation in the corresponding gene? a. mutant 1 b. mutant 2c. mutant 3d. mutant 4e. mutant 5
3. (1.8 points) The normal CFTR gene contains these six codons near the middle of the...
3. (1.8 points) The normal CFTR gene contains these six codons near the middle of the transcript: AUU UCU VUA GCA AGA GCU... Al The corresponding amino acids in the normal CFTR protein are: (Use either the one-or three-letter amino acid codes A naint mutation changes the last nucleotide from U to C. At the DNA level, this is a transition transversion c) At the protein level, this is a (silent / missense / nonsense/frameshift ) mutation. D) Instead of...
4. (4 pts) in premature termination of translation. These mutations are not as rare as you...
4. (4 pts) in premature termination of translation. These mutations are not as rare as you might think. For example, there are 8 different sense codons that can be changed to the stop codon UAG by a single point mutation (base change). Nonsense mutations are mutations that introduce a STOP codon in place of a sense codon, and result Using the codon table in the textbook, list these 8 sense codons (and their corresponding amino acid) Consider the following introduction...
Below is the coding DNA sequence for a gene called tribble, including the wild-type and several...
Below is the coding DNA sequence for a gene called tribble, including the wild-type and several mutant alleles. For each mutant allele, fully classify the mutation and its effect in the amino acid sequence. Wild-type 5'-ATGGCAACTACATATAGCACAGTTTGAACC-3' a. Mutant allele #1 5'-ATGGCAACTACATAAAGCACAGTTTGAACC-3' b. Mutant allele #2 5'-ATGGCAACTACATATAGCATAGTTTGAACC-3' c. Mutant allele #3 5'-ATGGCAACTACATACAGCACAGTTTGAACC-3' d. Which mutant allele is most likely to be a knockout and why?
Question 2: Transcription, RNA Processing and Translation A particular gene codes for a mature mRNA transcript...
Question 2: Transcription, RNA Processing and Translation A particular gene codes for a mature mRNA transcript containing 1200 bases, which is translated into a protein containing 300 amino acids. A. How long is the coding sequence in this mRNA and how many nucleotides are in the UTRs? For the purposes of this question we are ignoring the G’ cap and the polyA tail. B. A mutant form of the gene created by one nucleotide being changed to another nucleotide also...
Please answer all.... Thank you! 81)If a polypeptide chain contains 600 amino acids, then the gene...
Please answer all.... Thank you!
81)If a polypeptide chain contains 600 amino acids, then the
gene coding for this polypeptide must contain _____.
600 nucleotides
1200 nucleotides
1800 nucleotides
1800 codons
1800 anticodons
More than one of the above are correct.
82) When we altered gene triplet in the DNA produces a chain-terminating codon in the mRNA, the (1pts) result is called a reverse mutation nonsense mutation missense mutation spontaneous mutation frameshift mutation 83) A single base substitution changes the...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
Question 20 (1 point) Figure out the mutation. You will need the codon table to answer...
Question 20 (1 point) Figure out the mutation. You will need the codon table to answer this question. Wild type genomic sequence of a portion of a gene and the wild type sequence of portion of the protein gene product. The protein sequence only matches partially. TAT AAA GGG CGA CCA CCT GGT AAT GGG ACT TTG AGG Tyr Lys Gly Arg Pro Pro Ala Pro Arg Gin Tyr Trp Note: The five amino acids at the amino end of...
If the DNA template strand sequence at a particular region of a gene is 3-GGA-5. What...
If the DNA template strand sequence at a particular region of a gene is 3-GGA-5. What amino acid would this result in after transcription and translation? Pro (Proline) Ser (Serine) Val (Valine) Arg (Arginine) Question 20 1 pts What is created during transcription? a strand of codons O a strand of tRNA a strand of anticodons a polypeptide • a strand of DNA IPS Which letter (representing a phase of the cell cycle) would you observe (S phase) synthesis and...
Drag each statement below to classify it as true or false to review the studies that...
Drag each statement below to classify it as true or false to
review the studies that revealed the specifics of gene function in
organisms.
Drag each statement below to classify it as true or false to review the studies that revealed the specifics of gene function in organisms. All Neurospora mutants unable to synthesize arginine contained the same mutation in a single gene. At least four genes control arginine Synthesis in Neurospora, and these acted on different enzymes in the...
The answer is C but why?
15. Below is the middle region of a particular polypeptide. The wild-type amino acid sequence and the sequence of several mutant polypeptides are given ( ... indicates additional, unspecified amino acids). Which of the five mutant polypeptides is most likely to be the result of a nonsense mutation in the corresponding gene? a. mutant 1 b. mutant 2c. mutant 3d. mutant 4e. mutant 5
3. (1.8 points) The normal CFTR gene contains these six codons near the middle of the transcript: AUU UCU VUA GCA AGA GCU... Al The corresponding amino acids in the normal CFTR protein are: (Use either the one-or three-letter amino acid codes A naint mutation changes the last nucleotide from U to C. At the DNA level, this is a transition transversion c) At the protein level, this is a (silent / missense / nonsense/frameshift ) mutation. D) Instead of...
4. (4 pts) in premature termination of translation. These mutations are not as rare as you might think. For example, there are 8 different sense codons that can be changed to the stop codon UAG by a single point mutation (base change). Nonsense mutations are mutations that introduce a STOP codon in place of a sense codon, and result Using the codon table in the textbook, list these 8 sense codons (and their corresponding amino acid) Consider the following introduction...
Below is the coding DNA sequence for a gene called tribble, including the wild-type and several mutant alleles. For each mutant allele, fully classify the mutation and its effect in the amino acid sequence. Wild-type 5'-ATGGCAACTACATATAGCACAGTTTGAACC-3' a. Mutant allele #1 5'-ATGGCAACTACATAAAGCACAGTTTGAACC-3' b. Mutant allele #2 5'-ATGGCAACTACATATAGCATAGTTTGAACC-3' c. Mutant allele #3 5'-ATGGCAACTACATACAGCACAGTTTGAACC-3' d. Which mutant allele is most likely to be a knockout and why?
Please answer all.... Thank you!
81)If a polypeptide chain contains 600 amino acids, then the
gene coding for this polypeptide must contain _____.
600 nucleotides
1200 nucleotides
1800 nucleotides
1800 codons
1800 anticodons
More than one of the above are correct.
82) When we altered gene triplet in the DNA produces a chain-terminating codon in the mRNA, the (1pts) result is called a reverse mutation nonsense mutation missense mutation spontaneous mutation frameshift mutation 83) A single base substitution changes the...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
Question 20 (1 point) Figure out the mutation. You will need the codon table to answer this question. Wild type genomic sequence of a portion of a gene and the wild type sequence of portion of the protein gene product. The protein sequence only matches partially. TAT AAA GGG CGA CCA CCT GGT AAT GGG ACT TTG AGG Tyr Lys Gly Arg Pro Pro Ala Pro Arg Gin Tyr Trp Note: The five amino acids at the amino end of...
If the DNA template strand sequence at a particular region of a gene is 3-GGA-5. What amino acid would this result in after transcription and translation? Pro (Proline) Ser (Serine) Val (Valine) Arg (Arginine) Question 20 1 pts What is created during transcription? a strand of codons O a strand of tRNA a strand of anticodons a polypeptide • a strand of DNA IPS Which letter (representing a phase of the cell cycle) would you observe (S phase) synthesis and...
Drag each statement below to classify it as true or false to
review the studies that revealed the specifics of gene function in
organisms.
Drag each statement below to classify it as true or false to review the studies that revealed the specifics of gene function in organisms. All Neurospora mutants unable to synthesize arginine contained the same mutation in a single gene. At least four genes control arginine Synthesis in Neurospora, and these acted on different enzymes in the...
Most questions answered within 3 hours.
-
The comparisons of Scholastic Aptitude Test (SAT) scores based
on the highest level of education attained...
asked 1 minute from now -
A long solenoid has a diameter of 9.97 cm. When a current i
exists in its...
asked 6 minutes ago -
1. A motorcycle rider travels along a straight line with
constant velocity. He then throws a...
asked 23 minutes ago -
You are stopped at a red light at a freeway on-ramp. When the
light turns green,...
asked 21 minutes ago -
The freezing point of water H2O is 0.00°C at 1 atmosphere. How
many grams of manganese(II)...
asked 23 minutes ago -
explain the motives and methods for intrusion of the MS and Linux
operating systems
asked 23 minutes ago -
Are our social identities a) chosen for us or b) open to
negotiation? Pick a position...
asked 32 minutes ago -
A charge of -6 micro-coulombs is placed at the origin, a charge
of +7 micro-coulombs is...
asked 37 minutes ago -
What is the volume occupied by 0.254 mol of helium gas at 1.32
atm and 308...
asked 47 minutes ago -
The person in the drawing is standing on crutches. Assume that
the force exerted on each...
asked 51 minutes ago -
What’s in a name? A rose by any other name would smell
as sweet.” Although this...
asked 57 minutes ago -
A vending machine automatically pours soft drinks into cups. The
amount of soft drink dispensed into...
asked 59 minutes ago