Question 5 Which arrow points at a peptide bond? 1 R 3 2 Hydrogen bond R...
Question 1 (0.5 points) Which statement is true? O hydrogen always forms 1 bond all of the statements are true carbon always forms 4 bonds organic chemistry is the study of molecules made of carbon Question 2 (0.5 points) If a chain of three carbon atoms contains all carbon-carbon single bonds, how many hydrogen atoms are there? 6 10 12 8 Question 3 (0.5 points) If an alkane contains 4 carbon atoms, how many hydrogen atoms are there? 10 6...
1) Which bond is a peptide bond? 2) Which bond has the greatest polarity? 3) Which functional groups are hydrophobic? 4) which functional groups are hydrophilic? 5) Which functional group is an amino acid? 6) which functional group is an acid? (use the number to refer to the group) А В о н н н н он нон NTCICLN -С—N с — С-N. 6 н-с-н н н-С-н Ен н-с-н\ 5 С—N-н Н-с-Н S I3 H О—Н. С-Н С — н;...
Question 5 (1 point) Saved What arrow correctly identifies a peptide bond? LED H2N -CH-CJN-CH-C-R-CHCN-CH-8 CH-OH - CH₂ CH3 Question 4 (1 point) Identify all the amino acids that can be produced using the three letter designation (Use your textbook). HN-CH-C-N-CH-C-N-CH-C-N-CH-C CH-OH CH, 0 0 Al...Gly...-Cys...-Ser Gly.-.-Ala----Glu ---Met Glu----Ala----Thr----Cys Ala-Gly-Thr-Tyr 0 0 Question 3 (1 point) Use the three letter designation for the amino acids to write the tetrapeptide order: HN-CH-C-N-CH-C-N-CH-C-N-CH-C 525-5 Ala...Gly...Cys-..-Ser Gly....Ala---- Glu---- Met Glu---- Ala...-Thr-Cys OCys...-Ala----Gly-Ser Question...
3. What statement about the peptide bond is TRUE? a. Hydrolysis of the peptide bond is both thermodynamically and kinetically favorable. b. Kinetic stability of the peptide bond is overcome by the increased nucleophilicity of the catalytic residue of the protease. c. Formation of the acyl-enzyme intermediate distorts the resonance of the peptide bond. d.The catalytic strategy of proteases needs to overcome the thermodynamic stability of the peptide bond by making the...
QUESTION 12 What is the function of a peptide bond? A peptide bond is responsible for the secondary structure of a protein. To join the amino group of one amino acid to the carboxy group of another amino acid, A peptide bond is responsible for the tertiary structure of a protein A peptide bond joins the phosphate group at the 6 carbon of a new nucleotide to the hydroxyl (OH) group of the 3' carbon of a nucleotide already in...
1. Given the following peptide, which of the following statements is true? Question options: a) The N-terminal residue is leucine. b)This peptide contains 4 amino acid residues. c) The peptide contains a total of 6 ionizable groups. d) The net charge of this peptide at pH 7 is +1 Locate any peptide bond along the backbone of the given peptide. e) The bond between the C (of the C=O) and the N (of the N-H) of a peptide bond has...
Which of the following peptides will migrate the farthest in SDS-PAGE? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2: AWSDEGYIMN Peptide 3: MKLLVTYYICDEEPAQR Peptide 4: FVCCNTTRLEWWQNMSCKLAAPICNMRTTY Which of the following peptides will migrate the farthest in SDS-PAGE? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2: AWSDEGYIMN Peptide 3: MKLLVTYYICDEEPAQR Peptide 4: FVCCNTTRLEWWQNMSCKLAAPICNMRTTY Peptide 1 Peptide 2 Peptide 3 Peptide 4
Which of the following peptides will migrate the farthest in SDS-PAGE? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2: AWSDEGYIMN Peptide 3: MKLLVTYYICDEEPAQR Peptide 4: FVCCNTTRLEWWQNMSCKLAAPICNMRTTY Peptide 1 Peptide 2 Peptide 3 Peptide 4
2. a) (10 points) Rank the following hydrogen bonded pairs with respect to their hydrogen bond strengths (strongest: 1, weakest: 5) and explain briefly. to the other me to the hos o s como o b) (10 points) Rank the following halogen bonded pairs with respect to their halogen bond strengths (strongest: 1, weakest: 5) and explain briefly. HAC CH сн. N(CH) c) (10 points) Rank the following cations complexes with respect to their cation- interaction strengths in the gas...
Which of the following peptides will elute first in size-exclusion chromatography? Peptide 1: ASDCFRTYEWQCVNMKHFYLP Peptide 2: AWSDEGYIMN Peptide 3: MKLLVTYYICDEEPAQR Peptide 4: FVCCNTTRLEWWQNMSCKLAAPICNMRTTY O Peptide 1 Peptide 2 Peptide 3 Peptide 4