The figure shows an intron flanked by two exons. Splicing requires three sites to be recognized...
How are introns detected for splicing? USE THIS KEY: Splice sites are marked with specific nucleotide sequences. The intron begins with a FU and ends with an AG. Also, introns have an internal splice sited called a branch site.
5. A eukaryotic protein-encoding gene contains two introns and three exons: exon 1–intron 1–exon 2–intron 2–exon 3. The 5ʹ splice site at the boundary between exon 2 and intron 2 has been eliminated by a small deletion in the gene. Describe how the pre-mRNA encoded by this mutant gene would be spliced. Indicate which introns and exons would be found in the mRNA after splicing occurs
3of 3 9. The figure below represents the primary transcript of a gene that contains four exons (A, B, C, D) and two introns. The dark block in exon B indicates the position of an additional stop codon; the normal start and stop codons for translation are present in exons A and D respectively. The two arrows indicate alternative 3' splice sites for the first intron Pre-mRNA 5'I 3' intron intron Give a schematic representation of the mature mRNAs that...
A eukaryotic protein-encoding gene has three introns and 4 exons. A splicing repressor commonly binds to the 3' end of the second intron (introns 2/ exon three splice sites) draw the mRNA strand before and after splicing Diagram a final functional eukaryotic mRNA molecule from the 5' end to 3' end. There should be 7 items labeled in the diagram.
Sequence 1: 5' TAGGTGAAAGAGTAGCCTAGAATCAGTTA 3' Sequence 2: 5' TAACTGATTTCTTTCACCTA 3' a. Which sequence is the genomic fragment and which is the cDNA fragment? b. Write the RNA-like strand of the genomic sequence and indicate the 5' and 3 ends. Draw vertical lines between the bases that are the exon/ intron boundaries (Refer to the figure below for splice junction sequences.) (a) Short sequences dictate where splicing occurs. 30 nucleotides Exon 1 5' Intron Exon 2 3' Pu Pu GUPu Pu...CACUGAC...
Which of the following is not an RNA sequence that is recognized by the spliceosome during the process of splicing? O A. The 5' splice site OB. The 3' splice site o C. The promoter OD. The branch point O E. All of the above are recognized by the spliceosome What is the role of the Shine-Dalgarno sequence near the 5' end of prokaryotic mRNAS? O A. It is the sequence recognized by IF-2 OB. It establishes the position of...
The following is part of a mRNA from a gene with two exons and the intervening intron. The Upper Case nucleotides indicate the nucleotides that are recognized during splicing of the intron. 5'...GAU VAC AGg uau gug cuu ucc acc...300 bp...cug cag AUU ACA...3' Box the four individual nucleotides that are necessary to delineate the intron. The bold "g" was mutated to an "a". Splicing continues, but abnormally. What happens? What is the new (mutated) sequence of the mRNA molecule...
TTA Assignment 5 Finals Review oints) For splicing, introns are identified by the spliceosome by the following sequences: on the 5 side of the on: AAGT on the 3' end of the intron: CAGG. In the following DNA sequence, identify the splice sites, introns and ACAGG NA: A A GCG TAATTACTTACAGGTGGACATATCGTTATAGGCGT-3 TATTAATGAATGTACACGAGTATAGCAATATCCGCT-5' 'CAATGGAT What is the protein sequence once the mRNA is spliced (Use the codon chart on the last page? a. sequence bee as mutated to CTG G A...
Can someone please help with these two questions? Thank you.
4. Here is an RNA transcript freshly transcribed from a gene. It is immature, meaning that it has not been processed yet into a mature mRNA. a) If you could zoom in on this molecule, what two things would you observe at the molecular level that would indicate to you that it is RNA and not DNA? b) Which end of the molecule was the last bit to be transcribed,...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...