1. Factors that contribute to the mutation rate of any gene include: Choose all correct.
A. The size of the gene
B.The protein the gene will give rise to after translation
C.The nucleotide sequence (DNA or mRNA)
D.Spontaneous chemical changes
E. The location of the gene on the chromosome
(What is the correct answer)
2.Trinucleotides are really just:
A. A codon that will be read and converted into a single amino acid in a protein sequence
B.A piece of DNA that has no determined function, like an intron
C. Bits of DNA left over after transcription
D. Cellular waste product
3.Choose all the ways that a chemical can cause a genetic mutation.
A.It can cause a nucleotide substitution
B.It can cause RNA to fold around DNA
C. It can cause errant numbers of nucleotides to be added in DNA
D. It can cause structural changes in DNA that lead to mutation
E. It can cause DNA be degraded
F. It can cause RNA to be degraded
(A short answer)
4.What is a base analog and how does it confer a mutation into the new daughter DNA strand?
(1) Option no D is correct
The rate of mutation increases when you expose your body to harmful chemicals, radiation, buildup of free radicals or inadequate nutrients.
(2)
(3) option D is correct
1. Factors that contribute to the mutation rate of any gene include: Choose all correct. A....
1. Which repair mechanism is most likely affected if the enzyme DNA glycosylase is not functioning properly? photoreactivation repair base excision repair SOS repair double-strand break repair nucleotide excision repair 2. In bacteria and eukaryotes, a mutation is when ________. In bacteria and eukaryotes, a mutation is when ________. A.the nucleotide sequence in an mRNA molecule is directly changed B.the nucleotide sequence in a DNA molecule is directly changed C.the amino acid sequence in a protein molecule is directly changed...
ԿԱՆՉՈ» 2. Genes are made of DNA nucleotides. The gene for the beta chain of hemoglobin is 1,734 nucleotides in length and is located on the human chromosome 11. The mutation responsible for sickle-cell anemia affects a single nucleotide, which in turn changes a single amino acid. (9 pt) a. How are these nucleotides joined together to form a long polynucleotide chain? Name the relevant nucleotide constituents important for making the linkage. (see Slides 5-7 of Lecture 4b) (2 pt)...
1. Do all parts: a. The sequence of a gene on mRNA is normally AUGCCCGACUUU. The point mutation in the gene results in the MRNA sequence AUGCCGGACUUU. What are the amino acid sequence for the normal and mutant proteins? Say, with an explanation whether you expect this to be a silent mutation. b. Why is DNA polymerase said to be template-directed? If a RNA had the nucleotide sequence 5'-AUGCCAUAACGAUACCCCAGUC-3', what was the sequence of the DNA strand that was transcribed...
Genetics Worksheet Week 3: Gene Regulation and Epigenetics 1. Duchenne muscular dystrophy is caused by a mutation in a gene that is 2.5 million nucleotides in length and encodes a protein called dystrophin. The dystrophin protein itself is 3684 amino acids in length. Calculate below the approximate size of the mRNA that encodes dystrophin. Approximately what percentage of the gene that encodes dystrophin is intron sequence? The human genome encodes a much greater variety and number of proteins than the...
can you guys please give me the correct answers and explain why? 9. Which of the following statements is INCORRECT? A. Most human cells contain high levels of telomerase. B. Telomeres protect the ends of eukaryotic chromosomes. C. Telomerase is ribonucleoprotein D. Each round of replication shortens eukaryotic chromosomes. E. Telomerase is an RNA-dependent DNA polymerase. 10. DNA in front of the replication fork is positively supercoiled (over-wound). What is the source of energy required for this over-winding? Pollll Core...
Dystrophin is a protein that forms part of a vital protein complex that connects the cytoskeleton of a muscle fiber cell to the extracellular matrix. This connection strengthens and shapes the muscle fibers. Dystrophin is coded by the DMD gene. This is one of the longest human genes known, covering 2,300,000 base pairs (0.08% of the human genome) It is located in chromosome 21. The immature mRNA is 2,100,000 bases long and takes 16 hours to transcribe. It contains 79...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
Assume that the The DNA changes provided above represent the sequences in the TEMPLATE STRAND. Determine what effect would mutation 3 have on the protein. For location of mutation- either "Present in mature RNA"or "Absent in mature RNA" For Amino Acids- three letters in upper case, if no amino acids are formed, write "NA", if stop codon is coded write "STOP" For type of change-write "missense", "nonsense", "silent", "neutral" or "NA" Location of mutation Amino acid for Amino acid Type...
4. In future lectures we will describe a technique known as Northern blotting that can be used to detect RNA transcribed from a particular gene. Briefly, in this method a specific RNA is detected using a short segment of cloned DNA as a probe. The DNA probe, which is radioactive, is complementary to the RNA that the researcher wishes to detect. After the radioactive probe DNA basepairs to the RNA, the RNA is visualized as a dark (radioactive) band on...
Which of the following statements is FALSE? Nucleotides are only ever linked to one another 5’ to 3’ DNA can contain Uracil as a result of a chemical reaction MutS/MutL only works to repair the lagging strand of synthesis Alternative splicing happens in every eukaryotic gene All of these statements are false The protein that phosphorylates the CTD to initiate transcription is called EF-Tu eIF4 TFIID TFIIH RNA polymerase Which of these enzymatic activities in DNA replication require the input...