Identify the product(s) when the peptide Y-A-R-N is added to the trypsin at pH=7. (answer can...
Identify the product(s) when the peptide Y-A-R-N is added to the trypsin at pH=7. (answer can be more than one choice)
Y-A-R-N
Y
A
R
N
A-R-N
R-N
Y-A-R
Y-A
Homework Answers
Trypsin cuts arginine and lysine residues at the C-terminal of peptide chain.
The given peptide is
Tyrosine-alanine-arginine-asparagine
Conventionally, a polypeptide chain run in N---->C direction.
Therefore, the products of trypsin digestion for the given peptide chain would be Y-A-R- and N.
Add Answer to:
Identify the product(s) when the peptide Y-A-R-N is added to the
trypsin at pH=7. (answer can...
A) Draw the dipeptide R-T at pH 7 and CLEARLY label the peptide bond to be...
A) Draw the dipeptide R-T at pH 7 and CLEARLY label the peptide bond to be broken in the presence of trypsin. 3pts B) Draw the five-step mechanism for the trypsin cleavage of the dipeptide. 5pts C) Label the transition state each time it is formed. 1pt D) What mechanism is used to describe this bisubstrate reaction? 1 pt
2. (7 pts) What is the sequence of the following HEXAPEPTIDE? *PROVIDE WORK/ANSWER for B-F! (Use...
2. (7 pts) What is the sequence of the following HEXAPEPTIDE? *PROVIDE WORK/ANSWER for B-F! (Use deductive reasoning) Observations from Sequencing Experiments: A. The Sequence contains the following amino acids: Y, R, M, K, G,D B. Reaction with 1-fluoro-2,4-dinitrobenzene yielded DNP-G. C. Treatment with chymotrypsin yielded two tripeptides. D. Treatment with trypsin yielded three dipeptides. E. Treatment with carboxypeptidase yielded methionine. F. N-terminal sequencing of one of the chymotrypsin-produced tripeptides yielded DNP-K Explanation and summary of protein sequencing techniques •...
(7 pts) What is the sequence of the following HEXAPEPTIDE? *PROVIDE WORK/ANSWER for B-F! (Use deductive...
(7 pts) What is the sequence of the following HEXAPEPTIDE? *PROVIDE WORK/ANSWER for B-F! (Use deductive reasoning) Observations from Sequencing Experiments: A. The Sequence contains the following amino acids: Y, R, M, K, G, D B. Reaction with 1-fluoro-2,4-dinitrobenzene yielded DNP-G. ___ ___ ___ ____ ___ ___ y = 0.058x + 0.0081 y = 0.2711x + 0.0105 -0.02 0 0.02 0.04 0.06 0.08 0.1 0.12 0.14 -0.2 -0.1 0 0.1 0.2 0.3 0.4 0.5 Velocity ( mM/min) -1 [S] mM-1...
Can anyone confirm if these are correct? List and draw the structure(s) the amino acid(s) in...
Can anyone confirm if these are correct?
List and draw the structure(s) the amino acid(s) in which would have a-1 net charge at pH? List the amino acid(s) in which would have a + 1 net charge at pH 7? Draw the structure- of the peptide Arg-Asp-His-Ser-Gly at pH 7. List the N-terminus and C-terminus. Make sure the amide bonds are 'trans'. Give the products of a trypsin digestion of the peptide: His-phe-lys-val-asp-asp-arg-val Draw the full structure of the predominant...
Identify the major product(s) in the reaction of (R)-2-bromopentane with sodium cyanide in DMSO. Please draw...
Identify the major product(s) in the reaction of
(R)-2-bromopentane with sodium cyanide in DMSO. Please draw the
correct answer choice with its stereochemistry.
6) Identify the major product(s) in the reaction of (R)-2-bromopentane with sodium cyanide in DMSO. Please draw the correct answer choice with its stereochemistry. A) B) C) D) (S)-2-cyanopentane racemic mixture of 2-cyanopentane (R)-2-cyanopentane trans-2-pentene
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume...
Imagine that you have just isolated a peptide hormone with the following primary sequence: MLSCRLQEALAALSKIVLADLGCVTGAPSDPR (Assume the protein is in solution at physiological pH, and remember to include the amino acids at each end of the chain. A charge may come from the R-group, the N-terminus, and/or the C-terminus. If a residue occurs more than once, include each one in your answer.) List the residues (individual amino acids) that contribute a positive charge: List the residues that contribute a...
Please explain each part !! Thank you !! #3. Under experimental conditions, you purify a known,...
Please explain each part !! Thank you !!
#3. Under experimental conditions, you purify a known, biologically important peptide from human tissue. To determine the overall sequence, you then digest the pure peptide with trypsin and chymotrypsin (each separately) and then use mass spectrometry to identify the following sequence fragments from the overall peptide (shown in order of relative length, not necessarily in the order in which they are assembled in the whole, natural peptide). Trypsin cleavage products: Chymotrypsin cleavage...
sults in more than one other product being 7. Product-cost subsidization means that: A) when one...
sults in more than one other product being 7. Product-cost subsidization means that: A) when one product is overcosted, it results in more than overcosfed B) when a company undercosts more than one of its than one of its other products when a company undercosts one of its products, it will overcosta other products ) when one product is overcosted it result in all other products being o costs more than one of its products, it will overcost more e...
Use answers from answer bank and place in the correct bins. Peptides can be separated using...
Use answers from answer bank and place in the correct bins.
Peptides can be separated using an ion-exchange column based on their isoelectric (pl) values. At which pH values would two different peptides, one with a pl of 5.0 and the other with a pl of 9.2, bind to a cation- and anion-exchange column? Each peptide may be capable of binding to each column at more than one pH value. anion-exchange column at pH = 3.0 cation-exchange column at pH...
1. Given the following peptide, which of the following statements is true? Question options: a) The...
1. Given the following peptide, which of the following
statements is true?
Question options:
a) The N-terminal residue is leucine.
b)This peptide contains 4 amino acid residues.
c) The peptide contains a total of 6 ionizable groups.
d) The net charge of this peptide at pH 7 is +1 Locate any
peptide bond along the backbone of the given peptide.
e) The bond between the C (of the C=O) and the N (of the N-H) of
a peptide bond has...
2. (7 pts) What is the sequence of the following HEXAPEPTIDE? *PROVIDE WORK/ANSWER for B-F! (Use deductive reasoning) Observations from Sequencing Experiments: A. The Sequence contains the following amino acids: Y, R, M, K, G,D B. Reaction with 1-fluoro-2,4-dinitrobenzene yielded DNP-G. C. Treatment with chymotrypsin yielded two tripeptides. D. Treatment with trypsin yielded three dipeptides. E. Treatment with carboxypeptidase yielded methionine. F. N-terminal sequencing of one of the chymotrypsin-produced tripeptides yielded DNP-K Explanation and summary of protein sequencing techniques •...
Can anyone confirm if these are correct?
List and draw the structure(s) the amino acid(s) in which would have a-1 net charge at pH? List the amino acid(s) in which would have a + 1 net charge at pH 7? Draw the structure- of the peptide Arg-Asp-His-Ser-Gly at pH 7. List the N-terminus and C-terminus. Make sure the amide bonds are 'trans'. Give the products of a trypsin digestion of the peptide: His-phe-lys-val-asp-asp-arg-val Draw the full structure of the predominant...
Identify the major product(s) in the reaction of
(R)-2-bromopentane with sodium cyanide in DMSO. Please draw the
correct answer choice with its stereochemistry.
6) Identify the major product(s) in the reaction of (R)-2-bromopentane with sodium cyanide in DMSO. Please draw the correct answer choice with its stereochemistry. A) B) C) D) (S)-2-cyanopentane racemic mixture of 2-cyanopentane (R)-2-cyanopentane trans-2-pentene
Please explain each part !! Thank you !!
#3. Under experimental conditions, you purify a known, biologically important peptide from human tissue. To determine the overall sequence, you then digest the pure peptide with trypsin and chymotrypsin (each separately) and then use mass spectrometry to identify the following sequence fragments from the overall peptide (shown in order of relative length, not necessarily in the order in which they are assembled in the whole, natural peptide). Trypsin cleavage products: Chymotrypsin cleavage...
sults in more than one other product being 7. Product-cost subsidization means that: A) when one product is overcosted, it results in more than overcosfed B) when a company undercosts more than one of its than one of its other products when a company undercosts one of its products, it will overcosta other products ) when one product is overcosted it result in all other products being o costs more than one of its products, it will overcost more e...
Use answers from answer bank and place in the correct bins.
Peptides can be separated using an ion-exchange column based on their isoelectric (pl) values. At which pH values would two different peptides, one with a pl of 5.0 and the other with a pl of 9.2, bind to a cation- and anion-exchange column? Each peptide may be capable of binding to each column at more than one pH value. anion-exchange column at pH = 3.0 cation-exchange column at pH...
1. Given the following peptide, which of the following
statements is true?
Question options:
a) The N-terminal residue is leucine.
b)This peptide contains 4 amino acid residues.
c) The peptide contains a total of 6 ionizable groups.
d) The net charge of this peptide at pH 7 is +1 Locate any
peptide bond along the backbone of the given peptide.
e) The bond between the C (of the C=O) and the N (of the N-H) of
a peptide bond has...
Most questions answered within 3 hours.
-
A ball is dropped from a height h. Another ball is
launched vertically . The two...
asked 3 minutes ago -
R3. 81:
A newspaper reported that the revenue trends for the past five
years were up...
asked 54 minutes ago -
The decomposition of XY is second order in XY and has a rate
constant of 7.06×10−3...
asked 1 hour ago -
A three-phase induction motor is to be supplied through a 50
meter length.Determine the conductor size...
asked 1 hour ago -
A duopoly faces the following demand curve, Q = 30 - P (also P =
30...
asked 2 hours ago -
a reaction is second order with respect to one of its
reactants. By what factor will...
asked 2 hours ago -
anwser question 13 and 14
13. Data intergrity is a big deal in industry. why ?...
asked 2 hours ago -
26) Suppose the L and M genes are on the same chromosome but
separated by 100...
asked 2 hours ago -
A suggestion is made that the proportion of people who have food
allergies and/or sensitivities is...
asked 4 hours ago -
A refrigerator operates between temperatures of 294 and 253 K.
What would be its maximum coefficient...
asked 5 hours ago -
CHEM 2 (Step by step explanation please prefer if it were
handwritten)
A 100 mL aqueous...
asked 6 hours ago -
Doing a bio paper on Ann Atwater.
Born: July 1, 1935
Ann Atwater was an American...
asked 6 hours ago