Question

4. Which form of DNA is possible as well as the linear form? a. circular b....

4. Which form of DNA is possible as well as the linear form?

a. circular

b. stem loop

c. A-DNA

d. supercoiled

e. B-DNA

5. Why might a single base-pair mutation in eukaryotic mRNA be less serious than one in prokaryotic mRNA?

a. If the mutation occurs in the exon, it will not affect the gene product.

b. If the mutation occurs in the 3′ end of the start site, it will not affect the gene product.

c. If the mutation occurs in the intron or not in the splice site of a transcript with alternative splicing, it will not affect the gene product.

d. If the mutation occurs in the splice site of a transcript with alternative splicing, only one gene product may be affected.

e. If the mutation occurs in the 5′ end of the start site, it will not affect the gene product.

6. The step-by-step addition of deoxyribonucleotides to a DNA strand is catalyzed by:

a. polymerases.

b. topoisomerases.

c. helicase.

d. gyrase.

. endonuclease.

0 0
Add a comment Improve this question Transcribed image text
Answer #1

4. "(d) supercoiled form" of DNA is possible as well as linear form.

5. (c) If the mutation occurs in the intron or not in the splice site of a transcript with alternating splicing, it will not affect the gene product, that's why a single base-pair mutation in eukaryotic mRNA be less serious than one in prokaryotic mRNA.

6. The step-by-step addition of deoxyribonucleotides to a DNA strand is catalyzed by "(a) polymerases".

Add a comment
Know the answer?
Add Answer to:
4. Which form of DNA is possible as well as the linear form? a. circular b....
Your Answer:

Post as a guest

Your Name:

What's your source?

Earn Coins

Coins can be redeemed for fabulous gifts.

Not the answer you're looking for? Ask your own homework help question. Our experts will answer your question WITHIN MINUTES for Free.
Similar Homework Help Questions
  • 3of 3 9. The figure below represents the primary transcript of a gene that contains four exons (A, B, C, D) and two introns. The dark block in exon B indicates the position of an additional stop...

    3of 3 9. The figure below represents the primary transcript of a gene that contains four exons (A, B, C, D) and two introns. The dark block in exon B indicates the position of an additional stop codon; the normal start and stop codons for translation are present in exons A and D respectively. The two arrows indicate alternative 3' splice sites for the first intron Pre-mRNA 5'I 3' intron intron Give a schematic representation of the mature mRNAs that...

  • Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass trans...

    why is E the answer Below is the genomic DNA of gene X, a 3 exon gene that encodes a 131 amino acid single pass transmembrane protein. Shown are the transcriptional start site, splice donor, acceptor and branch sites and translational start and stop codons. Transcriptional start EXON 1 INTRON 1 EXON 2 INTRON 2 EXON 3 Spfice Donor Splice Acceptor Polyadenylation signal Branch point 17. Treatment with ethidium bromide, an intercalating agent, caused DNA polymerase to add an extra...

  • 21. The initiation of transcription of a gene occurs DNA when RNA polymerase binds to the...

    21. The initiation of transcription of a gene occurs DNA when RNA polymerase binds to the of the gene b. start codon c. exon 1 d. intron 1 e. splice site 22. Phosphodiester linkages are present in a. DNA b. mRNA c. tRNA d a and b e. all of the above 23. The 5' cap and poly A tail are added to a. pre-mRNA in the cytoplasm b. help with pre-mRNA splicing. c. protect mRNA d. assist in posttranslation...

  • can you guys please give me the correct answers and explain why? 9. Which of the...

    can you guys please give me the correct answers and explain why? 9. Which of the following statements is INCORRECT? A. Most human cells contain high levels of telomerase. B. Telomeres protect the ends of eukaryotic chromosomes. C. Telomerase is ribonucleoprotein D. Each round of replication shortens eukaryotic chromosomes. E. Telomerase is an RNA-dependent DNA polymerase. 10. DNA in front of the replication fork is positively supercoiled (over-wound). What is the source of energy required for this over-winding? Pollll Core...

  • Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...

    Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...

  • 4. In future lectures we will describe a technique known as Northern blotting that can be...

    4. In future lectures we will describe a technique known as Northern blotting that can be used to detect RNA transcribed from a particular gene. Briefly, in this method a specific RNA is detected using a short segment of cloned DNA as a probe. The DNA probe, which is radioactive, is complementary to the RNA that the researcher wishes to detect. After the radioactive probe DNA basepairs to the RNA, the RNA is visualized as a dark (radioactive) band on...

  • Genes in eukaryotes are often organized into exons and intrans, which require splicing to produce an...

    Genes in eukaryotes are often organized into exons and intrans, which require splicing to produce an mRNA that can be translated. The gene organization is the order of the DNA segments that comprise the gene starting with the promoter, the first exon, the first intron, the second exon, and so on. The interspersed intrans can make gene identification difficult in eukaryotesparticularly in higher eukaryotes with many introns and alternative spliced mRNAs. Prediction of many genes and their organization has been...

  • 1. DNA is coiled around what type of proteins to form nucleosomes A. Polymerases DNA replication...

    1. DNA is coiled around what type of proteins to form nucleosomes A. Polymerases DNA replication of the lagging strand is discontinuous B. Transcription factors DNA replication of the lagging strand is continuous C. Helicases D. Histones E. DICER 2. Which of the following statements is true? A. DNA replication of the leading strand is discontinuous B. DNA replication of the lagging strand is discontinuous C. DNA replication of the leading strand is dispersive D. DNA replication of the lagging...

  • 100 300 400 200 A>G 800 500 AGGUA 600 exon 1 Hexon 2 exon 3 700...

    100 300 400 200 A>G 800 500 AGGUA 600 exon 1 Hexon 2 exon 3 700 exon 4 CAG UGA AUG UAA AAAAA Lane: 1 2 3 Lane: 1 2 3 4 5 4 5 approx. size (bp) -900 approx. size (Da) -12,000 -11,000 -800 -700 - 10,000 -600 -9000 -500 -8000 -7000 -400 -300 -6000 Northern Blot Western Blot (fig56) At the top of the figure above is a gene diagram for a hypothetical gene, noting the length of...

  • QUESTION 1 MC. Which of the following disease conditions might NOT be treatable by RNAI? a....

    QUESTION 1 MC. Which of the following disease conditions might NOT be treatable by RNAI? a. arthritis b. Cancer caused by tumor suppressor gene mutation c. macular degeneration d. cancer caused by oncogen mutation S 5 QUESTION 2 MC. What is the molecular cause of male courtship behavior in fruit flies? a. Alternative splicing of the fruitless transcript b. RNA editing of the fruitless transcript C. Alternative sequence of the fruitless DNA d. Alternative 3' cleavage and polyadenylation of fruitless...

ADVERTISEMENT
Free Homework Help App
Download From Google Play
Scan Your Homework
to Get Instant Free Answers
Need Online Homework Help?
Ask a Question
Get Answers For Free
Most questions answered within 3 hours.
ADVERTISEMENT
ADVERTISEMENT
ADVERTISEMENT