Please circle the atoms on the dinitrophenyl derivative (from reacting with 1-fluoro-2,4-dinitrobenzene - Sanger's reagent) that originated from the N-term amino acid. Also please give the amino acid's identity.
__________________________________________________________________________
The amino acid bound with 2,4-dinitrobenzene is Valine.
Please circle the atoms on the dinitrophenyl derivative (from reacting with 1-fluoro-2,4-dinitrobenzene - Sanger's reagent) that...
A chain GIVEQCCASVCSLYQLENYCN B chain FVNQHLCGSHLVEALYLVCGERGFFYTPKA Shown above is the amino acid sequence of the hormone insulin. This structure was determined by Frederick Sanger and his coworkers. Most of this work is described in a series of articles published in the Biochemical Journal from 1945 to 1955. When Sanger and colleagues began their work in 1945, it was known that insulin was a small protein consisting of two or four polypeptide chains linked by disulfide bonds. Sanger and his coworkers...
please circle answer Shown below is the reaction between a nitrile and a Grignard reagent. What would be the first step in the mechanism? CN - 1. CH3MgBr 2. H307 Nucleophile attacks nitrile carbon Hydrolysis of the nitrile Protonate the nitrile nitrogen Base Beprotonates the alpha-carbon An unknown compound shows an infrared absorption around 2250 cm (medium intensity). What structural fragment could be causing this absorption? carbonyl OOH nitrile N-H NH 1. (CH3)2CHCOCI, pyridine 2. LIAIH4 3. H2O Product tertiary...
I need someone to help explain this to me please in great detail! Explain it to me very simply. thank you! 31) A nonapeptide was determined to have the following amino acid composition: (Lys)2, (Gly)2, (Phe) 2, His, Leu, Met. The following are possible sequences for the peptide. A) G-F-K-K-G-L-M -F-H B) H-L-G-K-K-F-F-G-M C) H-L-F-G-K-K-F-M -G D) H-F-L-G-K-K-F-M-G E) M-L-F-K-F-G-G-K-H The following observations were made during sequence determination. (Hint: FDNB reacts with N-terminal amino groups and specificities of proteases listed...
1. Partial hydrolysis of lysozyme yielded an octapeptide that was later identified as the N-terminal segment of the protein. From the following information, determine the sequence of this octapeptide. a. The following amino acids were identified after complete hydrolysis of the octapeptide: Arginine (Arg) Glycine (Gly) Phenylalanine (Phe) Cysteine (Cys) Leucine (Leu) Valine (Val) Glutamic Acid (Glu) Lysine (Lys) b. Treatment of the octapeptide with dinitroflurobenzene (Sanger reagent) followed by complete hydrolysis gave lysine (Lys) labeled with two dinitrophenyl (DNP) groups. c. Treatment of the octapeptide with trypsin gave lysine...
1.) Please help me to figure out if this is the correct product, and if you could also give me an arrow pushing mechanism. (Salicylic Acid + Benzylamine reacting with EDCI, Cat. DMAP and DMF). 2.) What is the purpose of adding EDCI as a coupling reagent? 3.) Which groups in this reaction can undergo any type of covalent and/or non covalent interaction with any enzymes or receptors? 4.) What are at least two other side products other than the...
IDENTIFICATION of an UNKNOWN ORGANIC COMPOUND PRE LAB QUESTIONS DATE NAME 1. Circle AND name four different functional groups in the compound to the right Macrocyclic lactone ring н сн N сн но. Нас Cн, O HO -O -он CH3 Hyc-OH CH3 Cн HyC OCH OH CH CH3 "сна 2. You have an unknown containing five carbon atoms, has a pH of 6, yields a yellow solution having no precipitate in a 2,4-DNP test, and produces a Jell-O like blue-green...
1. At what carbon atoms will these aromatics most likely undergo an EAS reaction? Circle them. Can you support your predictions with resonance structures? ÇOH more com- & - 2 2. Provide the curved arrows that interconvert these resonance structures of naphthol. 3. Tryptophan 7-Halogenase is an enzyme that chlorinates tryptophan at an activated position on the aromatic ring. First, the electrophilic chlorine source, HOCI is produced, shown in box 1. Then, a normal EAS mechanism is proposed to take...
Please explain! I know the answers already but I do not understand how to find them. H3 ОН (10) O(2) Question 2 (24 pts) This small protein has just the 6 ionizable side chains together with N and C termini (pK values in parentheses). 0.1 moles of the protein, in the ionic form shown, is dissolved in 1 L of pure water ("the(9H3N original solution"). Please answer the following questions COO a) what is the approximate pH of the original...
please identify the unknown and write a derivative Unknown compound 3 Clear liquid Physcial Properties Solubility Dissolve in ethyl ether Not dissolved in water Boiling point 77 IR spectrum Transmitance 3000 1000 2000 Wavenumber cm-1) Classification Positive test in Alkaline Iron (III) Hydroxamate test test CLASSIFICATION TESTS These tests must be done together with known AND FOLLOW PROCEDURE IN YOUR TEXT CARBOXYLIC ACIDS are detected by teating aqueous solutions with limus or pH paper. Also, disolve In NaHCO with bubbles...
NAME! Select the best answer and bubble it in on your blue scantron. 1. Where would be the absorption peak of a carbonyl, C-0, stretching in IR? a) around 3300 cm b) around 2980 cm" c) around 1700 cm d) around 1200 cm 2. What is the Grignard reagent in nucleophilic addition reaction considered? a) b) 0 c) H d) all the above 3. What a cynaohydrin contains? a) CN and NH. b) N, and OH. c) CN and OH....