Using the amino acid sequence of the protein you identified in question 1D, answer the following questions relating to humans.
The sequence is
MLSFVDTRTLLLLAVTSCLATCQCKCLQLVSGSLGKSGDRGPRGERGPPGPPGRDGDDGIPGPPGPPGPPGPPGLGGNFA AQFDAKGGGPGPMGLMGPRGPPGASGAPGPQGFQGPPGEPGEPGQTGPAGARGPPGPPGKAGEDGHPGKPGRPGERGVVG PQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSV GPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLPGAKGAAGLPGVAGA PGLPGPRGIPGPVGASGATGARGLVGEPGPAGSKGESGNKGEPGAVGQPGPPGPSGEEGKRGSTGEIGPAGPPGPPGLRG NPGSRGLPGADGRAGVMGPAGSRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGSPGNIGPAGKEGPVGLPGIDGRPGPI GPAGARGEPGNIGFPGPKGPSGDPGKAGEKGHAGLAGARGAPGPDGNNGAQGPPGLQGVQGGKGEQGPAGPPGFQGLPGP AGTAGEAGKPGERGIPGEFGLPGPAGARGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGAPGTAGPSGPSG LPGERGAAGIPGGKGEKGETGLRGDIGSPGRDGARGAPGAIGAPGPAGANGDRGEAGPAGPAGPAGPRGSPGERGEVGPA GPNGFAGPAGAAGQPGAKGERGTKGPKGENGPVGPTGPVGAAGPSGPNGPPGPAGSRGDGGPPGATGFPGAAGRTGPPGP SGISGPPGPPGPAGKEGLRGPRGDQGPVGRSGETGASGPPGFVGEKGPSGEPGTAGPPGTPGPQGLLGAPGFLGLPGSRG ERGLPGVAGSVGEPGPLGIAGPPGARGPPGNVGNPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNAGPVGAA GAPGPQGPVGPVGKHGNRGEPGPAGAVGPAGAVGPRGPSGPQGIRGDKGEPGDKGPRGLPGLKGHNGLQGLPGLAGHHGD QGAPGAVGPAGPRGPAGPSGPAGKDGRIGQPGAVGPAGIRGSQGSQGPAGPPGPPGPPGPPGPSGGGYEFGFDGDFYRAD QPRSPTSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTG ETCIRAQPEDIPVKNWYRNSKAKKHVWVGETINGGTQFEYNVEGVTTKEMATQLAFMRLLANHASQNITYHCKNSIAYMD EETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWQKTIIEYKTNKPSRLPILDIAPLDIGGADQEIRLNI GPVCFK
A) What is the human homolog of the protein?
B) What is the predicted localization of the protein?
C) Where WITHIN a cell is the protein predominantly found?
According to NCBI Protein BLAST, the given amino acid sequence showed 100% identity to collagen alpha-2(I) chain [Bos mutus].
To find out the human homolog of the protein, following steps were taken
1. Copy and paste the given sequence on NCBI PROTEIN BLAST.
2. In the organism blank, put humans or homo sapiens.
3. Click on blast.
The human homolog of the protein was found out to be collagen, type I, alpha 2[Homo sapiens] with 92.32% identity.
The predicted localization of the protein in humans is connective tissues namely skin, tendon, bone. Accounting for more than 90% of the organic mass of the bone and being the major component of skin, ligaments and tendon.
The gene encoding this protein is present on chromosome 7.
It is synthesized as a procollagen precursor molecule which is then cotranslationally translocated into the lumen of rough endoplasmic reticulum. Hence within a cell the protein is predominantly found in the lumen of rough endoplasmic reticulum.
After post translational modification proper folding of the polypeptide takes place in the endoplasmic reticulum. Later the procollagen molecules are transported through the golgi complex and released out of the cell. Wherein the mature collagen molecules arrange themselves into long, thin fibrils which cross-link in the spaces between the cells forming a mesh like network of the collagen fibres.
Using the amino acid sequence of the protein you identified in question 1D, answer the following...
QU. 5. You have identified the complete amino acid sequence on protein sequencing techniques. "Y" is composed of 44 amino acids with the po below. No information is available about its genetic sequence. Your task sequence for protein "Y". Assume that the gene sequence is unique in the human 5 BRIEFLY EXPLAIN methodically and accurately how you will decipher the gene seg "Y". (3 POINTS). no acid sequence of a human protein called "Y" using 1.44 amino acids with the...
QUESTION 9 Sequence analysis of a membrane protein shows four 20 amino acid long stretches of residues that are predominantly hydrophobic Between each of these stretches of hydrodophobic residues, a stretch of predominantly hydrophilic residues is found. From this observation one can reasonably postulate that: A this is a 4 stranded beta barrel which spans the membrane B.this is a glycoprotein o this protein has 4 alpha helical segments that span the membrane o this protein can be removed from...
What is the gene sequence(FASTA format) and amino acid sequence for the CFTR gene/protein? If you can provide a link to where you find this, that would be amazing!
As a scientist, you hypothesize that a particular sequence of amino acids leads to localization in the inner mitochondria membrane. How could you test this using a non-mitochondrial cytosolic protein? Include the following components in your answer. Hypothesis: Sequence X leads to localization in the inner mitochondrial membrane Experimental Control: Experimental Protein: Method (s): Result/Analysis:
Question 6 Using the provided Genetic Code, determine the amino acid sequence of a protein when the mRNA is AUGAUUGACUGA. Tyrosine – threonine – valine – glutamic acid Methionine - STOP Methionine – isoleucine – aspartic acid – STOP Lysine – arginine – glycine - STOP
Consider the following amino acid sequence, found as part of a larger protein: Pro-Gly-Asp-Val-Gln-Phe-Asp-Ile-Arg-Ala-Asp-Gly What kind of structure do you expect this peptide segment be a part of? Where on the protein is this likely to occur?
Compare the hemoglobin sequences on the following page and then answer parts A-C. Part A) Is there any difference in the amino acid sequence of the alpha subunits in normal and sickle cell hemoglobin? If yes, which amino acids are different? (Count the amino acids by their order in the sequence – first, second, third...) What amino acid or acids are in the normal alpha subunit and what amino acid or acids are in the sickle cell amino acid? Part...
What does the enzyme reverse transcriptase do? A) Using the amino acid sequence of a protein as a template, it makes an RNA molecule. B) Using RNA as a template, it makes a DNA molecule. C) Using RNA as a template, it makes an RNA molecule. D) Using DNA as a template, it makes an RNA molecule. E) Using DNA as a template, it makes a DNA molecule.
b and d please. c is an example
3. (25 points) You have predicted the amino acid sequences of several proteins based on their open reading frames. The significant domains are shown below. Diagram the final localization(s) (only as far as the ER or nucleus) and any orientation of domains for each protein. Also, indicate all regions that could be GLYCOSYLATED for each protein. No explanation needed if diagrammed and labeled clearly. Empty rectangle = 25 amino acid hydrophobic-rich sequence...
5. Integral glycoprotein sequence, 195mer (Note: amino acid sequence is broken into segments containing 10 amino acids, for ease in counting) EQRHNSD [BFP] GGN (10) TKERYFLLVI (20) TLIFSFTILV (30) VAVLILLSYG (40) MHSDQMGDYF (50) FFIIILLLTS (60) VVVTYILGFF (70) SYKHMYRNEE (80) QAASTDD [GFP] FGH (90) GNHGVSRNRW (100) PHKTSYFFFI (110) LVVVASFILF (120) FSFIFISSGG (130) VYTREFGDKG (140) SSADRPELIH (150) TREKHNWSLI (160) FFSFFVAVVS (170) ILLLFWSILI (180) LSYTSEKPLG (190) FKEEQ Experimental comments: A. Exposing the native membrane to an a-N-amippno fluorescent labeling agent, demonstrated NO retention...