Homework Answers
Different component of
influenza virus and its functions are as follows
1.Envelop : It is made up of lipid bilayer.It provides adaptability to the viruses.
2. Hemagglutinin : It is present on the surface of the influenza and helps in the attachment of the virus to the cells to be infected.
3. Neuraminidase : It acts as a receptor for the virus. It cuts or cleaves or removes the sciatic acid present on the viral glycoprotein.
4. Matrix protein : It plays important role in the virus assembly.
5.Nuclear export protein: Mediates the nuclear export encapsulated RNAs.
6.Capsid : It is a protein coat in which RNA is encapsulated.
7. RNA polymerase : Helps in the replication of RNA.
Add Answer to:
Please discuss the role of each influenza virion component (nucleic acid or protein) that you identified...
Question 1 Living cells contains protein, carbohydrates, lipids and nucleic acid. They can be classified into...
Question 1 Living cells contains protein, carbohydrates, lipids and nucleic acid. They can be classified into eucaryotes and procaryotes, where eucaryotes are more complex compared to procaryotes. a) Compare eucaryotes with procaryotes in terms of structure. (10 marks) b) Discuss the FIVE major biological functions of proteins, (10 marks) (Total: 20 marks)
Mae each cellular component to a role in transcription or translation in eukaryotic cells. protein complex...
Mae each cellular component to a role in transcription or translation in eukaryotic cells. protein complex that makes RNA polymers corresponding to a DNA template RNA polymerase Answer Bank location where transcription occurs TRNA region of DNA that recruits the transcriptional machinery promoter provides amino acids to growing protein chain ribosome site of protein synthesis nucleus about us | Careers privacy policy terms of use contact us help
In studying a particular biomolecule (a protein, nucleic acid, carbohydrate, or lipid) in the laboratory, the...
In studying a particular biomolecule (a protein, nucleic acid,
carbohydrate, or lipid) in the laboratory, the biochemist first
needs to separate it from other biomolecules in the sample (that
is, it needs to be purified). Specific purification techniques are
described later in the text. However, by looking at the monomeric
subunits and functional groups of a biomolecule, you should have
some ideas about the characteristics of the molecule that would
allow you to separate it from other molecules. Look for...
Predict the role of each component of an acid-base reaction Question Consider the reaction below. NH,...
Predict the role of each component of an acid-base reaction Question Consider the reaction below. NH, +H,0 = NH; + OH Which of the above chemical species is the conjugate base according to the Brønsted-Lowry definition? Sorry, that's incorrect. Try again? a Chemistry
Using the amino acid sequence of the protein you identified in question 1D, answer the following...
Using the amino acid sequence of the protein you identified in question 1D, answer the following questions relating to humans. The sequence is MLSFVDTRTLLLLAVTSCLATCQCKCLQLVSGSLGKSGDRGPRGERGPPGPPGRDGDDGIPGPPGPPGPPGPPGLGGNFA AQFDAKGGGPGPMGLMGPRGPPGASGAPGPQGFQGPPGEPGEPGQTGPAGARGPPGPPGKAGEDGHPGKPGRPGERGVVG PQGARGFPGTPGLPGFKGIRGHNGLDGLKGQPGAPGVKGEPGAPGENGTPGQTGARGLPGERGRVGAPGPAGARGSDGSV GPVGPAGPIGSAGPPGFPGAPGPKGELGPVGNPGPAGPAGPRGEVGLPGLSGPVGPPGNPGANGLPGAKGAAGLPGVAGA PGLPGPRGIPGPVGASGATGARGLVGEPGPAGSKGESGNKGEPGAVGQPGPPGPSGEEGKRGSTGEIGPAGPPGPPGLRG NPGSRGLPGADGRAGVMGPAGSRGATGPAGVRGPNGDSGRPGEPGLMGPRGFPGSPGNIGPAGKEGPVGLPGIDGRPGPI GPAGARGEPGNIGFPGPKGPSGDPGKAGEKGHAGLAGARGAPGPDGNNGAQGPPGLQGVQGGKGEQGPAGPPGFQGLPGP AGTAGEAGKPGERGIPGEFGLPGPAGARGERGPPGESGAAGPTGPIGSRGPSGPPGPDGNKGEPGVVGAPGTAGPSGPSG LPGERGAAGIPGGKGEKGETGLRGDIGSPGRDGARGAPGAIGAPGPAGANGDRGEAGPAGPAGPAGPRGSPGERGEVGPA GPNGFAGPAGAAGQPGAKGERGTKGPKGENGPVGPTGPVGAAGPSGPNGPPGPAGSRGDGGPPGATGFPGAAGRTGPPGP SGISGPPGPPGPAGKEGLRGPRGDQGPVGRSGETGASGPPGFVGEKGPSGEPGTAGPPGTPGPQGLLGAPGFLGLPGSRG ERGLPGVAGSVGEPGPLGIAGPPGARGPPGNVGNPGVNGAPGEAGRDGNPGNDGPPGRDGQPGHKGERGYPGNAGPVGAA GAPGPQGPVGPVGKHGNRGEPGPAGAVGPAGAVGPRGPSGPQGIRGDKGEPGDKGPRGLPGLKGHNGLQGLPGLAGHHGD QGAPGAVGPAGPRGPAGPSGPAGKDGRIGQPGAVGPAGIRGSQGSQGPAGPPGPPGPPGPPGPSGGGYEFGFDGDFYRAD QPRSPTSLRPKDYEVDATLKSLNNQIETLLTPEGSRKNPARTCRDLRLSHPEWSSGYYWIDPNQGCTMDAIKVYCDFSTG ETCIRAQPEDIPVKNWYRNSKAKKHVWVGETINGGTQFEYNVEGVTTKEMATQLAFMRLLANHASQNITYHCKNSIAYMD EETGNLKKAVILQGSNDVELVAEGNSRFTYTVLVDGCSKKTNEWQKTIIEYKTNKPSRLPILDIAPLDIGGADQEIRLNI GPVCFK A) What is the human homolog of the protein? B) What is the predicted localization of the protein? C) Where WITHIN a cell is the protein predominantly found?
Use the following to answer the questions below: For each of the nucleic acid situations, select...
Use the following to answer the questions below: For each of the nucleic acid situations, select the process with which it is associated using the response list. Responses may be used more than once or need not be used at all. a) translation phase of protein synthesis b) transcription phase of protein synthesis c) replication of DNA d) post-transcription phase of protein synthesis Okazaki fragments are formed.
QU. 5. You have identified the complete amino acid sequence on protein sequencing techniques. "Y" is...
QU. 5. You have identified the complete amino acid sequence on protein sequencing techniques. "Y" is composed of 44 amino acids with the po below. No information is available about its genetic sequence. Your task sequence for protein "Y". Assume that the gene sequence is unique in the human 5 BRIEFLY EXPLAIN methodically and accurately how you will decipher the gene seg "Y". (3 POINTS). no acid sequence of a human protein called "Y" using 1.44 amino acids with the...
#1- Once you have identified the definition of a core measure, please discuss how does the...
#1- Once you have identified the definition of a core measure, please discuss how does the implementation, measurement, and evaluation of the AMI core measures improve patient outcomes? #2- How can the role of the nurse in primary/ preventative care establish the foundation for reduction of risk factors associated with development of ACS?
In studying a particular biomolecule (a protein, nucleic acid, carbohydrate, or lipid) in the laboratory, the...
In studying a particular biomolecule (a protein, nucleic acid,
carbohydrate, or lipid) in the laboratory, the biochemist first
needs to separate it from other biomolecules in the sample (that
is, it needs to be purified). Specific purification techniques are
described later in the text. However, by looking at the monomeric
subunits and functional groups of a biomolecule, you should have
some ideas about the characteristics of the molecule that would
allow you to separate it from other molecules. Look for...
List 3 mechanisms of antibiotic resistance. (3pts) -Antimetabolite action (inhibit nucleic acid synthesis or function) -Alteration...
List 3 mechanisms of antibiotic resistance. (3pts) -Antimetabolite action (inhibit nucleic acid synthesis or function) -Alteration of cell membranes (Inhibit cell wall synthesis of function) -Inhibition of protein synthesis For the 3 mechanisms, you listed above, list an example, and the antibiotic the organism has become resistant to. (6pts)
Question 1 Living cells contains protein, carbohydrates, lipids and nucleic acid. They can be classified into eucaryotes and procaryotes, where eucaryotes are more complex compared to procaryotes. a) Compare eucaryotes with procaryotes in terms of structure. (10 marks) b) Discuss the FIVE major biological functions of proteins, (10 marks) (Total: 20 marks)
Mae each cellular component to a role in transcription or translation in eukaryotic cells. protein complex that makes RNA polymers corresponding to a DNA template RNA polymerase Answer Bank location where transcription occurs TRNA region of DNA that recruits the transcriptional machinery promoter provides amino acids to growing protein chain ribosome site of protein synthesis nucleus about us | Careers privacy policy terms of use contact us help
In studying a particular biomolecule (a protein, nucleic acid,
carbohydrate, or lipid) in the laboratory, the biochemist first
needs to separate it from other biomolecules in the sample (that
is, it needs to be purified). Specific purification techniques are
described later in the text. However, by looking at the monomeric
subunits and functional groups of a biomolecule, you should have
some ideas about the characteristics of the molecule that would
allow you to separate it from other molecules. Look for...
Predict the role of each component of an acid-base reaction Question Consider the reaction below. NH, +H,0 = NH; + OH Which of the above chemical species is the conjugate base according to the Brønsted-Lowry definition? Sorry, that's incorrect. Try again? a Chemistry
Use the following to answer the questions below: For each of the nucleic acid situations, select the process with which it is associated using the response list. Responses may be used more than once or need not be used at all. a) translation phase of protein synthesis b) transcription phase of protein synthesis c) replication of DNA d) post-transcription phase of protein synthesis Okazaki fragments are formed.
QU. 5. You have identified the complete amino acid sequence on protein sequencing techniques. "Y" is composed of 44 amino acids with the po below. No information is available about its genetic sequence. Your task sequence for protein "Y". Assume that the gene sequence is unique in the human 5 BRIEFLY EXPLAIN methodically and accurately how you will decipher the gene seg "Y". (3 POINTS). no acid sequence of a human protein called "Y" using 1.44 amino acids with the...
In studying a particular biomolecule (a protein, nucleic acid,
carbohydrate, or lipid) in the laboratory, the biochemist first
needs to separate it from other biomolecules in the sample (that
is, it needs to be purified). Specific purification techniques are
described later in the text. However, by looking at the monomeric
subunits and functional groups of a biomolecule, you should have
some ideas about the characteristics of the molecule that would
allow you to separate it from other molecules. Look for...
Most questions answered within 3 hours.
-
Quick question, I want to know how to convert decimal numbers to
binary number, when i...
asked 20 minutes ago -
You found out that now you are going to receive payments of
$8,500 for the next...
asked 23 minutes ago -
17.
Technician A says that leaking components are usually repaired
rather than replaced. Technician B says...
asked 24 minutes ago -
A) An Operon is:?
1- A gene that affect another gene
transcription.
2. A gene coding...
asked 31 minutes ago -
When opening a file, use this method to determine whether a file
exists before you attempt...
asked 35 minutes ago -
Sales total $300,000 when variable costs total $180,000 and
fixed costs are $60,000. Breakeven sales total:...
asked 42 minutes ago -
1)
To calculate the depth of a water well, an explorer drops a stone and with...
asked 39 minutes ago -
0.429-g sample of gas occupies 125 mL at 60. cm of Hg and 25°C.
The molar...
asked 41 minutes ago -
The
pH of a 0.90M solution of boric acid (H3BO3) is measured to be
4.64.
Calculate...
asked 1 hour ago -
on april 10, a company acquired land valued at $58,000 in
exchange for 1,000 shares of...
asked 1 hour ago -
Is
ampicillin or solvents (such as acetone) more effective at killing
off bacteria, in general? Explain...
asked 1 hour ago -
The current risk-free rate is 4.0% and the market risk premium
is 5.0%. If Ford Motor...
asked 1 hour ago