Homework Answers
1st one is absolutely correct answer because one amino acid is coded by triplet codon so 317 *3+3. +3 is triplet codon of stop codon which doesn't code any amino acid.
Add Answer to:
QUESTION 7 If the MC1R protein is 317 amino acids long why are there 954 base...
I have my own answers, i just want to check my work, thanks! Given the DNA...
I have my own answers, i just want to check my work,
thanks!
Given the DNA sequence below: 3'-CGTCCTTCTATACTTCGCGGAATGCCGGTCCATGTAGGTTCACATTAGCGT-5' (Coding strand) 1. Replicate the corresponding template strand by using the aforementioned coding strand. Label the 5' and 3' ends in the new strand. 2. Transcribe the template strand to an mRNA sequence. 3. Find the start and stop codons on the mRNA and enclose it in a box or label with different color. 4. Write the amino acid sequence of...
You are studying an interesting protein in nematode worms that is 100 amino acids in length....
You are studying an interesting protein in nematode worms that is 100 amino acids in length. Of particular interest is the fact that the last seven amino acids are all tryptophan (codons 94 through 100). Draw here the mRNA sequence for codons 94-100: Draw here the sequence of the DNA strand RNA polymerase used as its template (show 5' 3' polarity): You mutagenize the wild type worm. Assume for the next questions you are able to isolate both normal and...
DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2...
DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2 Gene 1 Gene 3 DNA strand3 TRANSLATION Protein Trp Gly Model 2 ACTIVITY and QUESTIONS 1. Based on the information you can gather from model 1 complete the following sentences: a. The nucleotide Adenine (A) always pairs with the nucleotide b. The nucleotide Guanine (G) always pairs with the...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
INSTRUCTIONS You may print out this assignment and fill it in by hand. We suggest using...
INSTRUCTIONS You may print out this assignment and fill it in by hand. We suggest using pencil in case you make mistakes!! Submit your Assignment as a single doc on Canvas. ASSIGNMENT 1) For the DNA sequence given below, write the complementary DNA sequence that would complete the double-strand. DNA 3-A TTGCT TACTTGCA T-5° DNA 5 2) Does it matter which strand is the 'code strand'? The following two sequences look identical, except one runs 3-5' and the other 5'-3'....
It is common for scientists to work backwards to find a Rene of interest.
4. It is common for scientists to work backwards to find a Rene of interest. They stan determining the sequence of amino acids in a protein that interests them. From the amino acid sequence, they can determine possible mRNA codons and then determine the possible DNA sequence for the gene of interest. They can then construct the gene and express it in a plant or microbe so that they can produce larger quantities of the protein. Indicate one possible mRNA...
QUESTION 29 How long would a mRNA coding for a protein with 106 amino acids be...
QUESTION 29 How long would a mRNA coding for a protein with 106 amino acids be if it had 5' and 3' UTRs of 30 bases each? (Assume stop codon is part of the last exon)
Question 16: The following shows the same segment of DNA that was shown above in Question...
Question 16: The following shows the same segment of DNA that was shown above in Question 15, however, this DNA sequence is for the mutant allele for the collagen type 1 gene. This mutated allele is responsible for a genetic skeletal disorder called osteogenesis imperfecta. 5' ATGCTATGGGCATGATCCCAGCCT 3' 3' TACGATACCCGTACTAGGGTCGGA 5' Answer the following questions: (a) If the bottom strand serves as the DNA template for transcription, what is the resulting mRNA sequence for this mutant allele? The mutated mRNA...
Question 2 (1 point) In order to target a protein to the endomembrane system, which of...
Question 2 (1 point) In order to target a protein to the endomembrane system, which of the following is required first? O a ER bound ribosome signal peptide on the N terminus of the polypeptide chaperone protein signal peptide on the C terminus of the polypeptide O signal-recognition particles A tRNA is chemically modified so that the amino acid bound is different than the one specified by its anticodon. Which codon in the mRNA would the tRNA recognize: the one...
pls fo all 20) A) an enzyme that synthesizes RNA as part of the transcription process...
pls fo all
20) A) an enzyme that synthesizes RNA as part of the transcription process B) an enzyme that uses RNA as a substrate C) an enzyme that catalyzes the association between the large and small ribosomal subunits D) an enzyme that synthesizes RNA primers during DNA replication E) an RNA with enzymatic activity 20) What is a ribozyme? 21) 21) Alternative RN A splicing A) increases the rate of transcription. B) can allow the production of similar proteins...
I have my own answers, i just want to check my work,
thanks!
Given the DNA sequence below: 3'-CGTCCTTCTATACTTCGCGGAATGCCGGTCCATGTAGGTTCACATTAGCGT-5' (Coding strand) 1. Replicate the corresponding template strand by using the aforementioned coding strand. Label the 5' and 3' ends in the new strand. 2. Transcribe the template strand to an mRNA sequence. 3. Find the start and stop codons on the mRNA and enclose it in a box or label with different color. 4. Write the amino acid sequence of...
You are studying an interesting protein in nematode worms that is 100 amino acids in length. Of particular interest is the fact that the last seven amino acids are all tryptophan (codons 94 through 100). Draw here the mRNA sequence for codons 94-100: Draw here the sequence of the DNA strand RNA polymerase used as its template (show 5' 3' polarity): You mutagenize the wild type worm. Assume for the next questions you are able to isolate both normal and...
DNA, Genes and Protein Synthesis Activity 13: Protein Synthesis is the process by which cells produce (synthesize) proteins. An overview of the process is shown in model 2 (below). Gone 2 Gene 1 Gene 3 DNA strand3 TRANSLATION Protein Trp Gly Model 2 ACTIVITY and QUESTIONS 1. Based on the information you can gather from model 1 complete the following sentences: a. The nucleotide Adenine (A) always pairs with the nucleotide b. The nucleotide Guanine (G) always pairs with the...
Questions 11-15: Gene structure/Splicing problem. "Protein X" consists of a total of 431 amino acids. Your colleague, techniques) the a biochemist, has purified the protein and determined (via complicated and messy chemical sequence of the first 37 amino acids in the protein, which she has reported to you as follows: HN- MSNITVDDELNLSREQQGFAEDDFIVIKEERETSLSP . nwhile, you have isolated a genomic clone of the gene that codes for protein X, and determined the DNA equence of the first 227 bases from the...
INSTRUCTIONS You may print out this assignment and fill it in by hand. We suggest using pencil in case you make mistakes!! Submit your Assignment as a single doc on Canvas. ASSIGNMENT 1) For the DNA sequence given below, write the complementary DNA sequence that would complete the double-strand. DNA 3-A TTGCT TACTTGCA T-5° DNA 5 2) Does it matter which strand is the 'code strand'? The following two sequences look identical, except one runs 3-5' and the other 5'-3'....
QUESTION 29 How long would a mRNA coding for a protein with 106 amino acids be if it had 5' and 3' UTRs of 30 bases each? (Assume stop codon is part of the last exon)
Question 16: The following shows the same segment of DNA that was shown above in Question 15, however, this DNA sequence is for the mutant allele for the collagen type 1 gene. This mutated allele is responsible for a genetic skeletal disorder called osteogenesis imperfecta. 5' ATGCTATGGGCATGATCCCAGCCT 3' 3' TACGATACCCGTACTAGGGTCGGA 5' Answer the following questions: (a) If the bottom strand serves as the DNA template for transcription, what is the resulting mRNA sequence for this mutant allele? The mutated mRNA...
Question 2 (1 point) In order to target a protein to the endomembrane system, which of the following is required first? O a ER bound ribosome signal peptide on the N terminus of the polypeptide chaperone protein signal peptide on the C terminus of the polypeptide O signal-recognition particles A tRNA is chemically modified so that the amino acid bound is different than the one specified by its anticodon. Which codon in the mRNA would the tRNA recognize: the one...
pls fo all
20) A) an enzyme that synthesizes RNA as part of the transcription process B) an enzyme that uses RNA as a substrate C) an enzyme that catalyzes the association between the large and small ribosomal subunits D) an enzyme that synthesizes RNA primers during DNA replication E) an RNA with enzymatic activity 20) What is a ribozyme? 21) 21) Alternative RN A splicing A) increases the rate of transcription. B) can allow the production of similar proteins...
Most questions answered within 3 hours.
-
If you titrated 30.0 mL of 0.1 M HCl with 0.1 M NaOH, indicate
the approximate...
asked 11 seconds from now -
NADH passes electrons into the electron transport chain. List
the carriers that would receive the electrons,...
asked 7 minutes ago -
A cylindrical cable with a resistivity of 1.6x10-8 Ω·m and cross
sectional area of 3x10-5 m^2...
asked 7 minutes ago -
True or False.
A consumer with convex preferences who is indifferent between
the bundles (5,2) and...
asked 11 minutes ago -
A diamond's index of refraction for red light, 656 nm, is 2.410,
while that for blue...
asked 24 minutes ago -
Compare HPLC, SPE, and GC. Identify the differences, the
advantages, and the weaknesses of each method.
asked 25 minutes ago -
Characteristic x-rays emitted by potassium have a wavelength of
0.374 nm. What is the energy of...
asked 28 minutes ago -
there is a function to create two random numbers between 1 and
25 and a function...
asked 46 minutes ago -
At a certain temperature, the ?pKp for the decomposition of
H2SH2S is 0.832.0.832.
H2S(g)↽−−⇀H2(g)+S(g)H2S(g)↽−−⇀H2(g)+S(g)
Initially, only...
asked 40 minutes ago -
Part 1.C&A Fast Food has four activities in serving a
customer: greet customer, take order, process...
asked 46 minutes ago -
Which attribute allows you to specify a custom "thumbnail" for
multimedia elements?
asked 1 hour ago -
How much 0.1200 M sodium hydroxide solution is need to titrate
14 mL of a 0.100...
asked 1 hour ago